(data stored in ACNUC7421 zone)

EMBL: CP000386.PE531

CP000386.PE531       Location/Qualifiers
FT   CDS_pept        complement(567915..568403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0538"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG:
FT                   reu:Reut_A0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03512"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL6"
FT                   /protein_id="ABG03512.1"
FT                   /translation="MAIDRGLRTFVEEMQLPDRAIDGEKIPWVPQGERVWFKPLRFDLA
FT                   GGRWINLLKVEGGGKVNRHRHTGGQVLGYCVEGSWRYLERDWVARPGTLVYEPPGDIHT
FT                   LVVDEESGGMVTLFILEGSVQYLDDEDNLIYQDDVFSKLRRYLDYCEQRGIEPEDLCY"
     gtggcgatcg acagagggct acggactttc gtcgaggaga tgcagctgcc cgaccgggcg        60
     atagacggcg agaagatacc gtgggtaccg cagggcgagc gggtgtggtt caagcctttg       120
     aggttcgacc tcgccggcgg gcgttggatc aacctgctca aggtcgaggg gggcgggaag       180
     gtcaaccgcc accggcacac cggagggcag gtgctcggct actgcgtaga gggctcctgg       240
     cgctacctgg agcgcgactg ggtggcgagg cccggcacgc tcgtctacga gccgccgggc       300
     gacatccaca ccctggtggt ggacgaggag agcgggggga tggtcaccct cttcatcctc       360
     gaggggagcg tccagtacct ggacgatgag gacaacctga tctaccagga cgacgtcttc       420
     tcgaagctgc ggcgctacct ggattactgc gagcagcgcg ggatagagcc cgaggacctc       480
     tgctactga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page