(data stored in ACNUC7421 zone)

EMBL: CP000386.PE536

CP000386.PE536       Location/Qualifiers
FT   CDS_pept        571275..572318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0543"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: bja:blr3675 putative
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03517"
FT                   /db_xref="GOA:Q1AYL1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL1"
FT                   /protein_id="ABG03517.1"
FT                   /translation="MKAARLYEYDPELEGQEFLKVEEVPEPEIEAPDDVIVRVGGAGVC
FT                   RTDLHIIEGLWDEALVVEPPYTLGHENAGWVEEAGSSVSRFAPGDAVVIQPALSDGTCL
FT                   SCLRGRNNLCESLVWIGIQQNGGFAEYVRVKERNLVKLPENVEPRDAAPYADAGLTAYH
FT                   ATKKAARVLDAGDVAVVIGIGGLGHIGVQVLKALSPARVVALDRSEGALRLAEEVGADH
FT                   VVNSAGDAVDRVLELTGGRGAQAVVDFVGEADVPARALAMTRTGGYYFVVGYGGEIRVP
FT                   TMEMIATEKSIVGNIGGTTSELHELIALAGEGKVRMNVRHYPLEEANRALLDLHEGRIH
FT                   GRGVLVP"
     atgaaggccg cgcgcctgta cgagtacgac cccgagctcg aggggcagga gttcctgaag        60
     gtggaggagg ttcccgagcc cgaaatcgag gcgcccgatg acgtgatagt gcgggtcggc       120
     ggggcggggg tgtgcaggac ggacttgcac atcatcgagg ggctctggga cgaggcgctg       180
     gtcgtcgagc ctccctacac tctggggcac gagaacgccg ggtgggtgga ggaggccgga       240
     tcctccgtga gccggttcgc gccgggggac gcggtcgtga tccagcccgc cctctccgac       300
     gggacgtgcc tctcctgcct cagggggcgc aacaacctgt gcgagagcct ggtctggatc       360
     ggcatccagc agaacggcgg gttcgccgag tacgtgcggg tcaaggagcg caacctcgtg       420
     aagctgcccg agaatgtcga gcccagggac gccgccccct acgccgacgc gggcctcacc       480
     gcttaccacg ccaccaagaa ggcggcccgg gtcctcgacg cgggcgacgt ggccgtggtc       540
     atcgggatcg ggggtctggg acacatcggc gtccaggtgc tcaaggccct gagcccggcc       600
     cgcgtcgttg ccctggacag gtccgaggga gccctccggc tggccgagga ggtcggcgcg       660
     gatcacgtcg tgaacagcgc cggggacgcg gtggacaggg tgctggagct cacgggcggc       720
     aggggggcgc aggcggtcgt cgacttcgtg ggggaggccg acgtgccggc acgggcgctg       780
     gcgatgaccc ggacgggagg gtactacttc gtcgtcgggt acggcgggga gatccgggtc       840
     cccaccatgg agatgatcgc caccgagaag agtatcgtgg gcaacatcgg cggtaccacg       900
     agcgagctgc acgagctcat cgccctggcc ggcgagggca aggttcgcat gaacgtgcgc       960
     cactacccgc tggaggaggc gaaccgggcg ctcctcgacc tgcacgaggg caggatccac      1020
     gggcggggcg tgctggtccc ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page