(data stored in ACNUC7421 zone)

EMBL: CP000386.PE542

CP000386.PE542       Location/Qualifiers
FT   CDS_pept        complement(577966..578970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0549"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sai:Saci_2121 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03523"
FT                   /db_xref="GOA:Q1AYK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK5"
FT                   /protein_id="ABG03523.1"
FT                   /translation="MAGQSATGGREGLLPRLSGALLERREAGIFAVAVALVVYFQAANA
FT                   AFLTQGNLRALAQFAATTAIIAVGLVMVMILGEIDLSVGQAYGFAPIVMYLAYERLLLV
FT                   LPLAIAVALAATAVVGFANGALRVYFGVPSFVATLGTFFLLGGLNVILTGGFPRPAPEE
FT                   SALKQALGAYPYAGILWATGIMIIMHAVLNHTRWGIHTFATGGNFTGAREAGIRVDRIR
FT                   IGNFMLCSVLGGFAGIIEAMRIDSIDPLVGGAEIMFYAIAAAVIGGTPLAGGVGTVIGA
FT                   FIGTLVISILRNGFTLQGVNANEFNIILGVAVLIVMALNIYVGRLRRGRRAPT"
     atggctgggc agagcgcaac cggcgggcgg gaggggctgc tgccccggct ctccggcgcg        60
     ctgctggaga ggcgggaggc cggcatcttc gcggtggcgg tcgcgctcgt ggtctacttc       120
     caggccgcca acgccgcctt cctcacccag ggcaacctcc gggcgctggc gcagttcgcc       180
     gccaccaccg ccatcatcgc ggtggggctg gtgatggtca tgatcctggg ggagatagac       240
     ctctccgtgg gccaggccta cgggttcgcc cccatcgtca tgtacctggc ctacgagcgg       300
     ctgctgctcg tgctcccgct cgccatagcc gtggcgctcg cggcgacggc ggtggtgggc       360
     ttcgccaacg gggcgctgcg cgtgtacttc ggggtcccct ccttcgtggc caccctgggg       420
     accttcttcc tgctcggggg gctcaacgtc atcctcaccg ggggcttccc ccgcccggcc       480
     cccgaggaga gcgcgctcaa gcaggcgctc ggggcctacc cctacgcggg catcctgtgg       540
     gccacgggca tcatgatcat catgcacgcc gtgctcaacc acacccgctg gggcatccac       600
     accttcgcca ccgggggcaa cttcaccggg gccagggagg ccggcatccg ggtggaccgc       660
     atcaggatcg gcaacttcat gctgtgcagc gtgctcgggg ggttcgccgg gatcatcgag       720
     gcgatgcgca tagactccat agacccgctc gtcggggggg ccgagatcat gttctacgcc       780
     atcgccgcgg cggtcatcgg ggggacgccg ctcgcgggcg gggtggggac ggtcatcggg       840
     gcgtttatcg ggacgctggt gatctccatc ctgcgcaacg gcttcaccct gcagggggtc       900
     aacgccaacg agttcaacat catcctcggg gtggccgtcc tgatcgtgat ggcgctcaac       960
     atctacgtgg gccggctgcg ccgggggagg agggccccga catga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page