(data stored in ACNUC7421 zone)

EMBL: CP000386.PE553

CP000386.PE553       Location/Qualifiers
FT   CDS_pept        587827..589305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0560"
FT                   /product="Protein-tyrosine kinase"
FT                   /EC_number="2.7.10.1"
FT                   /note="PFAM: lipopolysaccharide biosynthesis; KEGG:
FT                   fra:Francci3_3472 protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03534"
FT                   /db_xref="GOA:Q1AYJ4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ4"
FT                   /protein_id="ABG03534.1"
FT                   /translation="MRDENHLRQRRSTNGPEAGPPPDDEIVISLDELLRVLWRRAWIIA
FT                   LVAGLLTAAAAGFSLLRTPIYEASIQIVIGQREGAAPTNLGSDVMGLQQLTRTMAEVLE
FT                   SRTVANAVIREMNLPTDAETFLENMTVEPVTETQVIEVSYRDPDPERAQQVANTIGRVF
FT                   SEQVSDLSPSANAVTATVWERAQLPDEPVSPQPLRNAAMALVLGLMLGTGAAFLVEHLD
FT                   DRWRSPEDAEQVSGVPTFGVVRQFDTSGGKRRRGRLLRRRGDKKEDMLDLAGRLVTLVD
FT                   QDGLAAEDYRSLRTNLFYAFVDAPPRAIVTTSPGPREGKSTTCANLGVALAQAGRSTLL
FT                   LDCDLRKPVVHEIFGLRNIRGVVDVLAGTRELREVWHSPVPNLRVVPTGPIPPNPAELL
FT                   SSRRFQQMLEEARGQFDYVLMDAPPVEAVSDPVILATHSDGVLLVIDAQNTRKGAVRRA
FT                   MRSLEAVGARVLGTVLNNAGETEGGYYYYRRYGY"
     ttgcgcgacg agaaccatct tagacagcgg cgttctacga acgggccgga ggccggtcct        60
     cccccggacg acgagatcgt aatctccctc gacgagcttc tgcgggtgct ctggcggcgg       120
     gcctggatca tcgcgctcgt ggccgggctc ctcacggcgg ctgcggcggg cttcagcctg       180
     ctccggaccc ccatctacga ggcctccatc cagatcgtca tcggccagcg ggagggcgcc       240
     gcgcccacca acctgggcag cgacgtgatg ggcctgcagc agctcacccg caccatggcc       300
     gaggtgctcg agtcccgcac cgtggccaac gccgtcatcc gggagatgaa cctccccacc       360
     gacgccgaga ccttcctgga gaacatgacc gtcgagccgg tgaccgagac ccaggtcatc       420
     gaggtctcct accgggaccc cgaccccgag cgggcgcagc aggtggccaa caccatcggc       480
     cgggtcttct ccgagcaggt ctcggatctc agcccgagcg ccaacgccgt caccgccacc       540
     gtctgggagc gggcgcagct ccccgacgag ccggtgagcc cccagccgct gcgcaacgcg       600
     gccatggccc tcgtcctcgg cctcatgctg ggcaccggag ccgccttcct cgtcgagcac       660
     ctcgacgacc gctggcgctc ccccgaggac gccgagcagg tctccggcgt gcccaccttc       720
     ggcgtcgtgc ggcagttcga cacctccggg ggcaagcgcc gcagggggag gctgctgcgc       780
     cgccgcggcg acaaaaagga ggacatgctg gacctcgccg ggaggctcgt caccctggtg       840
     gaccaggacg ggctcgccgc cgaggactac cgcagcctgc gcaccaacct cttctacgcc       900
     ttcgtggacg ccccgccgcg ggccatcgtc accaccagcc ccggcccgcg ggaggggaag       960
     agcaccacct gcgccaacct gggcgtggcg ctcgcccagg ccgggaggag caccctgctc      1020
     ctcgactgcg acctgcgcaa gccggtggtg cacgagatct tcgggctgcg caacatccgc      1080
     ggcgtggtgg acgtgctcgc gggcaccagg gagctgcgcg aggtgtggca ctcgccggtg      1140
     cccaacctgc gggtcgtgcc caccggcccc atccccccca accccgccga gctgctcagc      1200
     tcccggcgct tccagcagat gctcgaggag gcccgcgggc agttcgacta cgtcctcatg      1260
     gacgcgcccc ccgtcgaggc cgtctccgac ccggtgatcc tggccaccca cagcgacggg      1320
     gttctgctgg tcatagacgc gcagaacacc cgcaagggcg ccgtgcggcg ggccatgcgc      1380
     agcctcgagg ccgtgggggc gagggtcttg ggcaccgtgc tcaacaacgc cggcgagacc      1440
     gagggcggct actactatta ccgcaggtat ggctactaa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page