(data stored in ACNUC7421 zone)

EMBL: CP000386.PE554

CP000386.PE554       Location/Qualifiers
FT   CDS_pept        589575..590945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0561"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   noc:Noc_1513 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03535"
FT                   /db_xref="GOA:Q1AYJ3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ3"
FT                   /protein_id="ABG03535.1"
FT                   /translation="MMGLSSSMFDKYVLLSLKRRLFSGGAWAFAGRVGTMFFGLASNAL
FT                   LARLLSPQDLGTYFLAFSVASFGAMAGSLGLNQAAVRLIAESLGTGQFGRTRRVVGAVI
FT                   VLGVLGILIIGCLYLLLLGRFLGTDLFDAPSLVAITWLVAGWMAVLTWQEILSGVFRGF
FT                   HDIRWATVFGGLMTSVLLATSLLLLWLFQEESTLATVVLLAIVSGGASALLGGWLLRLK
FT                   VTSIPLEGALNQRAFKTVAGVAWPLLITNLTLFALMQVDLWILGAFRSQEEVAIYGAAA
FT                   RLAALVVAPLAVVNAVVPPLIAEMYAQGRRGELERMLRFTAALAAAPALLTVLGFTILG
FT                   VPILTLVYGGYYREGTVVLALLSLGQMASVLTGSCALTLMMTGHQVTSMIITVAAGVLM
FT                   IIVALQVVDPYGATGVAVATCGGLVFQNVVMWLMAKRKTGIWTHFSFSVLRSIRGFS"
     ttgatggggt tatcatcttc tatgtttgat aagtacgtgc ttctttcact aaaacgtcgc        60
     ctcttttctg gtggagcatg ggcgtttgct ggcagagttg gaacgatgtt ttttgggctt       120
     gcttctaatg ctttgttggc aagattgctt tccccgcagg atctgggcac ttactttctg       180
     gcttttagcg ttgcttcctt tggtgccatg gcgggttcgc tgggattgaa tcaggcggcc       240
     gtgcgcctta tcgctgaaag cctcgggaca ggccagtttg ggcgaacacg ccgtgtagtc       300
     ggcgcagtaa ttgtgctggg tgtgctaggg atcctaatca ttggctgttt gtatttactg       360
     ctcttgggac gttttttggg caccgatttg ttcgacgcgc cgagtcttgt ggcgattact       420
     tggctagtgg cggggtggat ggcagtccta acgtggcaag agatcctgtc tggtgttttt       480
     agaggattcc acgatatacg ctgggctacc gtctttggcg gtttaatgac tagcgtcctt       540
     ctggccactt ctttgttgct gttgtggtta tttcaggagg aatctactct ggctaccgtg       600
     gtgcttctcg ctatagtttc ggggggtgcc agtgctctgc ttggaggctg gctcttgcgg       660
     cttaaggtta cttctatccc tctagagggc gctttaaatc agagagcctt taaaacagta       720
     gcaggtgtag cttggccgct tttgataacc aacttgacgt tattcgccct catgcaagta       780
     gacctgtgga ttctaggcgc tttccggtcg caagaagagg tcgcaatata tggcgcagcg       840
     gcacgcttgg cggcgttagt ggtagcgccg ttggcagtag tcaatgcagt ggtgccgccc       900
     ttgatagcag agatgtatgc tcagggaagg agaggagaat tggagcgtat gctccgtttc       960
     acggccgcgc tcgctgcagc tccggcactt ttgacggtgc tcgggttcac catcctgggt      1020
     gtgccgatac tgactctagt gtacggcggc tactaccgcg agggtacagt ggtgctggct      1080
     ttgctgagtc tgggccagat ggcaagtgta ctcacaggct cttgtgccct aaccttgatg      1140
     atgactggcc accaagtgac ttcaatgata atcaccgttg ctgcaggtgt tctgatgatt      1200
     atagttgccc ttcaagtggt cgatccctac ggtgcaactg gagtagcggt cgccacttgt      1260
     ggagggttag tctttcagaa tgtggttatg tggcttatgg cgaaacggaa gaccggtatc      1320
     tggacacact ttagctttag cgtgcttcgc tcgataagag gcttctcatg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page