(data stored in ACNUC7421 zone)

EMBL: CP000386.PE557

CP000386.PE557       Location/Qualifiers
FT   CDS_pept        592846..593838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0564"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   tbd:Tbd_0313 rhamnosyl transferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03538"
FT                   /db_xref="GOA:Q1AYJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ0"
FT                   /protein_id="ABG03538.1"
FT                   /translation="MGMDDSKGPEVYVVILNWNGWQDTIECLESLFRSRYTRYRVVVCD
FT                   NGSDDGSLENIKAWAEGRLDLPFSSDNPLRYLAPIPKPVPYVEHDREVRDGDCVEGCTR
FT                   FLVLVRTGANLGFAGGNNVGIRYALERKADYVWLLNNDTVTDLNALGAMVNVAQSDPDI
FT                   GAVGSTIYYMDAPNDIQLYGGGWVSFWLGICRHFTTSVSDDKLGYVAGTSLLLRREVLE
FT                   QVGLLDDKFFMYWEDTDYGIRVREAGWKLAVAPESRIWHRESAALGKKNPVLYTYFNAS
FT                   AVRFFRKFSPLPFVPISVGVGGRFLKRVMQGDWNQAKAVWQGALAGCRE"
     atggggatgg acgattctaa gggaccggaa gtctacgtcg ttatccttaa ctggaacgga        60
     tggcaggata ctattgagtg tctggagagt ctgtttcgga gtcgttacac tcgttaccga       120
     gtggtcgtct gtgataacgg ctcagatgat ggttcattgg agaacatcaa agcttgggcc       180
     gagggacgtt tggatttgcc attttccagc gataatccgc tgcgttatct cgctcctatc       240
     cccaaacccg ttccctatgt cgagcatgat agagaggtga gggacggaga ctgcgtggaa       300
     ggatgtacgc gattcctagt gctcgtccgc acgggtgcca atttaggctt cgccggtggc       360
     aacaacgtgg gaattcgata cgctctggag agaaaagccg actacgtttg gctactcaac       420
     aacgacacgg ttacggacct aaacgcgctt ggagcaatgg taaatgtggc acagagtgat       480
     cccgacattg gtgcagtagg atcaaccatt tattacatgg acgcaccaaa tgatattcaa       540
     ctctacggtg gaggttgggt gagtttctgg ttggggatat gtcggcactt tacgacttcc       600
     gtttcagacg acaagttagg gtacgtagct gggaccagtt tgttactccg gcgagaggtc       660
     ttagagcaag ttggtctctt agacgacaag tttttcatgt attgggagga tacggactac       720
     gggattagag tacgagaggc tggttggaaa cttgcggtgg cgcccgagtc tagaatttgg       780
     catagagagt cggccgcgct ggggaagaag aacccagtac tttatactta ctttaatgcg       840
     tcagcggtgc gcttcttcag aaagtttagt ccccttcctt ttgtcccgat atcggtaggg       900
     gttggagggc gcttcttgaa gcgggtaatg cagggcgatt ggaaccaggc aaaggctgtg       960
     tggcagggcg ctttagcagg gtgtagagaa tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page