(data stored in ACNUC7421 zone)

EMBL: CP000386.PE558

CP000386.PE558       Location/Qualifiers
FT   CDS_pept        594291..595172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03539"
FT                   /db_xref="GOA:Q1AYI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI9"
FT                   /protein_id="ABG03539.1"
FT                   /translation="MPTASADAFFEVFSWSFYGEVRAFSLFGSASKFGHYIALVGALGI
FT                   SFLYSEKLEAKAAGLVLTILVLAAGFATLTRATYMEILMTLFAAWLLVRPRGTLLKYLV
FT                   SLLPLVYGVTGAFVAFALPSWITVASNRSPLLSDNTLLMRYASWDTYGGLWMESDLFAK
FT                   LFGMGIIQNNRFPVTENVLIDNSFLALLIHIGLLGLMVWLMLMWALWRYVLRVAISHGS
FT                   PLAVAIAAIWSTWMATGVFGITTEGYPLLLVLLLLSSVGGKAEAFRKRNPWEENLQSRR
FT                   SESNHSSCWQKA"
     ttgccgacgg cttcggcgga tgctttcttt gaggtattct cctggagctt ctatggtgag        60
     gtaagagcct tctccctctt cggctcggct tccaagttcg gccactacat cgcgcttgta       120
     ggagcgctcg gcatatcttt cctctacagc gagaagcttg aagccaaagc cgccggcctc       180
     gtgcttacca tcctggtttt ggcagcaggg tttgccactc taacccgggc tacctatatg       240
     gagatcctta tgaccctgtt cgctgcttgg ctgctagtgc gacctagagg aactctctta       300
     aagtatttgg tctctctatt gcctttagta tatggcgtga caggagcctt tgtagccttc       360
     gctttaccgt cgtggattac cgtagcaagt aaccggagcc ctctcctttc ggacaacact       420
     ctcctcatgc gttacgctag ctgggatacc tacggcggct tatggatgga gagcgatctg       480
     tttgccaaac tcttcggcat gggtataatt caaaataacc gattcccggt caccgaaaat       540
     gtgctcatcg ataattcctt tctcgctttg ttgatccaca ttggcttgct tgggctcatg       600
     gtatggctga tgttgatgtg ggcactatgg cgatatgtgt taagagttgc aataagccat       660
     ggcagtcctc tcgccgttgc catcgctgcg atctggtcta catggatggc tacgggtgtc       720
     ttcggcatta ctacagaagg atatccgctg cttctggtgc ttttgttgct gagttcggtt       780
     ggaggcaaag cggaggcttt tcgcaagaga aacccatggg aggaaaacct acaaagcagg       840
     cgttcggaga gtaaccacag ctcttgttgg cagaaggctt ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page