(data stored in ACNUC7421 zone)

EMBL: CP000386.PE565

CP000386.PE565       Location/Qualifiers
FT   CDS_pept        603080..603967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0574"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; KEGG:
FT                   sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03546"
FT                   /db_xref="GOA:Q1AYI2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI2"
FT                   /protein_id="ABG03546.1"
FT                   /translation="MAEREDGERRAGVADGRVRALLQRLFDGSRLSPTQRRLARYVMDH
FT                   PDEALFLSSVELARRVGVSQPSVTRLAVAMGYGGYGELQRELRAVALEGGGGGAGSEAP
FT                   NKFQGAVRAEIENLRALERSLEDTGAVEELGRELAASEPLCVLGLRVSAPLAGYFGYFA
FT                   KKIHPDVRVLTEGGSAAFDALAQARAAGGAWVLCFLLPRHPRETLQAMSYARSLGLRVA
FT                   TVADRETGWIRELSDAVLPAEVGTRLVFDSQAAAMVLAGVLLEALSDAAPKRAQERLEE
FT                   FEQRAARLGFFETG"
     gtggcggaga gagaggacgg tgagcggaga gccggggtag ccgacgggcg ggtgcgggcc        60
     ctgttgcagc ggctcttcga cgggagcagg ctctctccca cccagcgccg gctcgcccgc       120
     tacgtcatgg accatcccga cgaggcgctg tttctgtcga gcgtggagct ggcccggcgg       180
     gtgggggtga gccagccttc ggtgacgcgc ctggccgtgg cgatggggta tgggggctac       240
     ggggagctgc agagggagct gcgcgcggtg gccctggagg gagggggtgg gggggccggg       300
     tcggaggcgc cgaacaagtt ccagggggcg gtgcgggccg agatcgagaa cctgcgggcg       360
     ctggagcgct cgttggagga caccggggcc gtggaggagc tggggaggga gcttgccgcc       420
     tcggagccct tgtgcgtgct ggggctgcgg gtctccgcgc cgctcgccgg gtacttcggt       480
     tacttcgcga agaagatcca ccccgacgtc cgcgtcctca cagagggcgg cagcgcggcc       540
     ttcgacgccc tggcgcaggc gcgggcggcg ggcggggcgt gggtcttgtg ctttctgctg       600
     ccgcgccacc cgcgggagac gctccaggcc atgagctacg cccggtcgct ggggctgcgg       660
     gtggccacgg tggcggaccg ggagacgggc tggataaggg agctgagcga cgcggtgctg       720
     cccgccgagg tcggcacccg gctcgtcttc gactcgcagg cggcggcgat ggtgctcgcc       780
     ggggtgcttc tggaggcgct ctcggacgcc gcgccgaagc gggcgcagga gcggctggag       840
     gagttcgagc agcgggcggc gcgtctgggg ttcttcgaga cgggatga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page