(data stored in ACNUC7421 zone)

EMBL: CP000386.PE568

CP000386.PE568       Location/Qualifiers
FT   CDS_pept        607231..608235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0577"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   sco:SCO2931 putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03549"
FT                   /db_xref="GOA:Q1AYH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH9"
FT                   /protein_id="ABG03549.1"
FT                   /translation="MPRSSCQGCISERTGDAMIEFRGVTKTYPGSERPAVENLSFEVPE
FT                   GEICVLVGPSGCGKTTTMRMINRLIEPTEGEILIGGEPNTRISGTELRRKIGYAIQQIG
FT                   LFPHRTIAENVGTVPSLLEWDRERIRRRVDELLELVGLDPAGFRDRYPAELSGGQQQRV
FT                   GVARALAADPPIMLMDEPFGAVDPITRERLQDEFLKIQQDIKKTIVFVTHDIDEAIKLG
FT                   DRIAILKEGGTLAQYDSPENILTSPASEFVASFVGADRVLKRLSLTRLEEVELDPPRGN
FT                   GGLPRLPEQASLKDALSEMIGSGAERVLVLSGDGGVRGSLSLDGLRRLSGRAG"
     ttgccgagat cttcctgtca gggttgtata tctgagcgta caggggatgc gatgatcgag        60
     ttcaggggcg tcaccaagac ctaccccggc tcggagcggc ctgcggtgga aaacctctcc       120
     ttcgaggtgc cggagggcga gatctgcgtc ctcgtggggc cctcgggctg cggcaagacc       180
     accaccatgc ggatgatcaa ccggctcatc gagccgacgg agggcgagat cctcatcggc       240
     ggcgagccga acacccggat aagcggcacc gagctgcggc gcaagatcgg gtacgccatc       300
     cagcagatag ggctcttccc ccaccggacc atcgcggaga acgtggggac cgtccccagc       360
     ctgctggagt gggacaggga gcgcatccgg cggcgggtgg acgagctgct ggagctcgtc       420
     ggcctcgacc ccgccgggtt ccgggaccgc tacccggcgg agctctccgg gggccagcag       480
     cagcgggtag gggtggcgcg ggcgctcgcg gccgaccccc ccataatgct catggacgag       540
     cccttcgggg cggtggaccc cataacccgc gagcggctgc aggacgagtt cctgaagatc       600
     cagcaggaca taaagaagac catcgtcttc gtcacccacg acatagacga ggccataaag       660
     ctgggcgaca ggatcgccat ccttaaggag ggcggcaccc tcgcccagta cgacagcccg       720
     gagaacatcc tcaccagccc cgcctcggag ttcgtggcct ccttcgtggg ggcggacagg       780
     gtgctcaagc ggctctccct cacccggctc gaggaggtcg agctcgaccc cccgcggggc       840
     aacggcggcc tgccgcgcct cccggagcag gcctccctca aggacgcgct ctcggagatg       900
     atcggctcgg gcgccgaacg ggtgctggtg ctctccggtg acggcggggt gcgcggctcg       960
     ctgagcctcg acgggctgcg gcggctctcc ggcagggccg ggtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page