(data stored in ACNUC7421 zone)

EMBL: CP000386.PE57

CP000386.PE57        Location/Qualifiers
FT   CDS_pept        58656..59624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0057"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2+ transporter protein, CorA-like; KEGG:
FT                   tfu:Tfu_1428 magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03038"
FT                   /db_xref="GOA:Q1AZZ0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ0"
FT                   /protein_id="ABG03038.1"
FT                   /translation="MIVDRAIYVDGKRAELSGAAEDTYAACRRRGGMAWIGLYEPDEAE
FT                   FSSVAEEFGLHPLAVEDAVHAHQRPKLEKYGDTYFVVLKTARYVDETETVEFGEIHVFV
FT                   GEDFVVTVRHGEASALRGVRERLEGDRELLRRGPASILYAIMDRVVDDYGPVVDGLEND
FT                   IDEIESEVFGGSPHVSRRIYELSREVVEFHRATRPLAGVLERMLSDGGPPLDVELKRYM
FT                   RDVHDHAIRTNEQIEGFRELISNILNVNLTLVSVEQNDEVKRISAWAAILFAPTVIAGI
FT                   YGMNFDRMPELHWDFGYPFALALMLGVSGVLYALFRRRGWL"
     atgatcgtgg accgcgccat atacgtggac ggcaagcgag ccgagctctc cggggccgct        60
     gaggacacct acgcggcctg ccgccgcagg ggagggatgg cctggatcgg gctgtacgag       120
     cccgacgagg ccgagttctc ctccgtggcc gaggagttcg ggctgcaccc gctggcggtc       180
     gaggacgccg tgcacgccca ccagcggccc aagctcgaga agtacgggga cacctacttc       240
     gtggtgctca agaccgcccg ctacgtggac gagaccgaga ccgtggagtt cggcgagatc       300
     cacgtgttcg tcggcgagga cttcgtggtc accgtccgcc acggcgaggc ctccgcgctg       360
     cggggggtgc gcgagcggct ggagggggac cgcgagctgc tgcgccgggg cccggcctcc       420
     atcctctacg cgatcatgga ccgcgtggtc gacgactacg ggcccgtggt cgacgggctc       480
     gagaacgaca tcgacgagat agagagcgag gtcttcggcg gcagcccgca cgtctcccgc       540
     cggatctacg agctctcccg cgaggtggtg gagttccacc gcgccacccg gccgctggcg       600
     ggggtgctgg agcgcatgct ctcggacggg gggccgccgc tggacgtgga gctcaagcgc       660
     tacatgcgcg acgtccacga ccacgccatc cggaccaacg agcagataga gggcttcagg       720
     gagctgatct ccaacatcct gaacgtcaac ctcacgctgg tcagcgtgga gcagaacgac       780
     gaggtgaagc ggatcagcgc ctgggccgcg atcctcttcg cccccacggt gatagccggg       840
     atctacggga tgaacttcga ccggatgccg gagctgcact gggatttcgg ctacccgttc       900
     gcgctggcgc tgatgctcgg cgtctcgggg gtgctctacg cgctcttcag gcgccgcggg       960
     tggctgtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page