(data stored in ACNUC7421 zone)

EMBL: CP000386.PE571

CP000386.PE571       Location/Qualifiers
FT   CDS_pept        609626..610591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0580"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: cyb:CYB_0579 quaternary
FT                   amine uptake ABC transporter (QAT) family, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03552"
FT                   /db_xref="GOA:Q1AYH6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH6"
FT                   /protein_id="ABG03552.1"
FT                   /translation="MKNNTRPIQAVLVLLTPFALAIVFLVACGNVGESGGSGPGAGEGG
FT                   GPAITVGSKNFTEQYILGNMYALALEDAGFKVERRLNLGSEQIADRALQNGQIDLYPEY
FT                   TGTALAAVLDYEGDPAQLDTPEQTYQRAKELYAGRDPADTMLRPAPFNNTYAIFVRREA
FT                   AKRYDLRTLEDLAEASPNLVFVSFSEFQHREDNFKNMKENYNFDFKDVEIVNSIGLRYQ
FT                   GVLQGEGDVGVGFTTDGQLASDRLVVLEDPKSIWPFYQPAPVVRTEVLEKNPKIREVLN
FT                   EVSASLDVETMRRLNGRVDLQKEDPEDVAREYLEREGLIK"
     atgaagaaca atactcgacc gattcaagct gtgctggtgc tgctaactcc gttcgcgctc        60
     gcgatagttt ttctcgtcgc ctgcggcaac gtgggcgaga gcggcggctc cggccccggc       120
     gccggggaag ggggaggccc cgcgatcacc gtgggctcca agaacttcac cgagcagtac       180
     atcctcggca acatgtacgc cctggcgctc gaggacgccg gcttcaaggt ggagcggcgg       240
     ctgaacctcg gcagcgagca gatcgccgac agggccctcc agaacgggca gatagacctc       300
     tatcccgagt acaccggcac cgcgctggcc gcggtgctcg actacgaggg cgacccggcg       360
     cagctggaca ccccggagca gacctaccag agggcgaagg agctctacgc cgggcgcgat       420
     ccggccgaca ccatgctcag gcccgcgccc ttcaacaaca cctacgccat cttcgtgcgc       480
     cgggaggccg ccaagcgcta cgacctgagg acgctcgagg atctcgccga ggcctccccg       540
     aacctggtgt tcgtctcctt ctccgagttt cagcaccgcg aggacaactt taagaacatg       600
     aaagagaact ataacttcga cttcaaggac gtggagatcg tcaacagcat cgggctccgc       660
     taccaggggg tgctgcaggg cgagggggac gtcggggtgg gcttcaccac cgacggccag       720
     ctggcctccg accggctggt ggtgctcgag gaccccaaga gcatctggcc cttctaccag       780
     cccgcccccg tggtgcgcac cgaggtgctc gagaagaacc cgaagatccg ggaggtcctc       840
     aacgaggtct cggccagcct cgacgtggag accatgcgaa ggctcaacgg ccgggtggac       900
     ctccagaagg aggacccgga ggacgtggcc cgggagtatc tggagcggga gggtctcatt       960
     aagtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page