(data stored in ACNUC7421 zone)

EMBL: CP000386.PE573

CP000386.PE573       Location/Qualifiers
FT   CDS_pept        612077..613294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0582"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: gka:GK3252 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: Amidase,
FT                   hydantoinase/carbamoylase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03554"
FT                   /db_xref="GOA:Q1AYH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH4"
FT                   /protein_id="ABG03554.1"
FT                   /translation="MDIKRVRERLEELFALAPDPRGGATRLAYSPEEARAMRLVAGWLE
FT                   EAGLSARLDRFGNLWGLPPAGGRLVTGGSHVDTVPNGGRLDGALGTVLAVEAAGELEGP
FT                   FGVLVCAGEEAPRFGAGTLGSRQLAGRLGEAELARMRDRDGVSALAAREEFLRLLRDIP
FT                   RLEEPDPLSRVAAHLEVHVEQRRWLGERGASVGIATAVAGPERYRLLLSGQSGHSGEAR
FT                   MPERRDALCAAAEVILLVEGAARKASSTVATVGTVRVEPGSLTAVPGRVELGLDVRGTD
FT                   PGEAGELVRLVLERGRGICARRGVSFSARRLSRAAPVALDEGVVGLAERVARREGIPAA
FT                   RCVSFAGHDVQHLARRVPAALLFAASSNGVSHAPGEEVGEEDLERTYRMARALMPELAR
FT                   EYGGER"
     atggatatta agcgcgtgcg ggagcgcctg gaggagctct tcgccctggc ccccgacccc        60
     cgcggcggcg cgacccgcct cgcctactcc ccggaggagg cgcgggcgat gcggctcgtg       120
     gccggctggt tggaggaggc cgggctctcc gcgcgcctcg accgcttcgg gaacctgtgg       180
     gggctgccgc cggcgggggg gcggctcgtc acgggcggct cgcacgtgga caccgtcccg       240
     aacggcgggc ggctcgacgg ggccctgggg accgtgctgg ccgtggaggc ggcgggggag       300
     ctggaggggc cgttcggggt gctggtgtgc gcgggggagg aggcgccccg cttcggggcc       360
     ggcaccctgg gctcccggca gctcgcgggg aggctggggg aggcggagct cgcgcggatg       420
     cgcgaccggg atggggtctc ggcgctcgcg gcgcgggagg agtttctgcg cctgctccgg       480
     gacatccccc gcctggagga gcccgacccg ctctctcggg tcgcggcgca cctggaggtg       540
     cacgtcgagc agcgcaggtg gctcggggag aggggcgcct ccgtcggcat cgccacggcg       600
     gtggccggcc cggagcgcta ccgcctgctc ctctcgggac agagcggcca ctcgggggag       660
     gcccggatgc ccgagcgccg cgacgccctg tgcgcggcgg cggaggtcat cctgctcgtg       720
     gagggggcgg cccgcaaggc gtcctccacc gtggccaccg tcgggaccgt gcgggtcgag       780
     cccggctccc tcaccgccgt ccccgggcgg gtggagctcg gcctcgacgt gcgcgggacc       840
     gaccccgggg aggccgggga gctcgtacgg ctggtcctgg agcgggggcg cgggatctgc       900
     gcgcgcaggg gcgtctcctt ctccgcccgg cgcctctccc gcgcggcccc ggtggcgctg       960
     gacgaggggg tggtggggct ggccgagcgc gtagcgcgca gggagggcat ccccgccgcg      1020
     aggtgcgtca gcttcgccgg gcacgacgtc cagcacctcg cccggcgggt gccggcggcg      1080
     ctgctcttcg ccgcctcttc caacggcgtg agccacgcgc cgggggagga ggtgggggag      1140
     gaggatctgg agaggacgta caggatggcg agggcgctca tgcccgagct ggcgagagag      1200
     tacggaggag agagatga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page