(data stored in ACNUC7421 zone)

EMBL: CP000386.PE579

CP000386.PE579       Location/Qualifiers
FT   CDS_pept        619658..620347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: sth:STH750 two-component
FT                   response regulator, probably involved in phosphate sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03560"
FT                   /db_xref="GOA:Q1AYG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG8"
FT                   /protein_id="ABG03560.1"
FT                   /translation="MSGSILLVIGDDEERLRLRRALHGEGWRVLPAGTGAQARQIAGRE
FT                   DFEVAVVDNRLPDERGFQVISAVQKPDVATVALLHDEDTMDRIVGIELGADYYMRSPVN
FT                   PRELVARVKQIFRKRERAAGEPSGKVYVGDLEIDPEQIRVTKGGREVMLSPREFKLLYT
FT                   LARSPGRVFPRGTLLRQVWGEDEYIDERTVNVYVQRLRNKLGDDPSDPKLIETVRGFGY
FT                   RLVRPEG"
     ttgagcggat ccattctcct ggtcataggc gacgacgaag agcggctgcg cctcaggcgg        60
     gccctgcacg gcgaggggtg gcgggtgctc ccggccggga cgggggcgca ggcgcgccag       120
     atcgccggga gggaggactt cgaggtcgcc gtggtggaca accggctgcc ggacgagcgg       180
     ggcttccagg tgatctctgc ggtgcagaag ccggacgtgg ccaccgtggc gctgctgcac       240
     gacgaggaca cgatggaccg catagtcggg atagagctgg gcgcggacta ctacatgcgc       300
     tcgccggtga acccgcggga gctggtggcg cgggttaagc agatcttccg caagcgggag       360
     cgggcggccg gggagccctc gggcaaggtc tacgtggggg acctggagat cgacccggag       420
     cagatccggg tgacgaaggg gggcagggag gtgatgctct cgccccggga gttcaagctg       480
     ctgtacacgc tggcccgcag cccggggcgg gtgttcccgc gcgggacgct gctgcggcag       540
     gtgtggggcg aggacgagta catcgacgag cggacggtga acgtctacgt gcagcgcctg       600
     cgcaacaagc tgggggacga cccctccgac ccgaagctga tcgagacggt gcgcggcttc       660
     ggctaccggc tggtgcggcc ggagggctag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page