(data stored in ACNUC7421 zone)

EMBL: CP000386.PE580

CP000386.PE580       Location/Qualifiers
FT   CDS_pept        complement(620344..620970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0590"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   tfu:Tfu_0639 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03561"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG7"
FT                   /protein_id="ABG03561.1"
FT                   /translation="MKRLSREDLAPPAVTLLALALALLAFVLYLQGRPPGEGSAEAGFA
FT                   RDMSVHHAQAVEMAGIVRDKTRDPAIRTLATDITLTQQAQIGQMHGWLAAWGLPLTGTG
FT                   PPMAWMGHAGRMPGMATPEQINRLRDAPPEEADRLFLRLMIEHHRGAIPMAEAALERTD
FT                   RPEVERLAGAILRSQRGEIRLMQQMLRERGGEAPARPHAGRHRGG"
     gtgaagcggc tttcccggga ggatctcgcg cccccggcgg tgaccctcct cgccctggcg        60
     ctcgccctcc tcgccttcgt cctctatttg caggggcggc cgcccgggga gggctcggcc       120
     gaggccgggt tcgcccgcga catgtccgtc caccacgccc aggccgtgga gatggcgggc       180
     atcgtgcggg acaagacccg cgaccccgcc atccgcaccc tcgccaccga catcacgctc       240
     acccagcagg cccagatcgg gcagatgcac ggctggctcg ccgcgtgggg gctccccctc       300
     accgggaccg ggccgcccat ggcctggatg gggcacgcgg gcaggatgcc cggcatggcc       360
     accccggagc agataaaccg gctcagagac gccccgcccg aggaggccga ccggctcttt       420
     ctgcggctca tgatcgagca ccaccggggc gccatcccca tggcagaggc cgcgctcgag       480
     cgcaccgacc gccccgaggt agagcgcctc gccggggcca tcctgcgctc acagcgcggc       540
     gagatccggc tgatgcaaca gatgctccgg gagcggggcg gggaggcgcc ggcccggccg       600
     cacgccgggc ggcaccgcgg gggctag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page