(data stored in ACNUC7421 zone)

EMBL: CP000386.PE581

CP000386.PE581       Location/Qualifiers
FT   CDS_pept        complement(620967..621626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03562"
FT                   /db_xref="GOA:Q1AYG6"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG6"
FT                   /protein_id="ABG03562.1"
FT                   /translation="MNGTTAPRRLRASISGGTKSYTAERFGALGRIRREPRGGGRMNAV
FT                   YLVAGGIVLALIVAFAVFAVLDSRRGGGEIAGVRSYDVGPGNRHTRGEVDYEQTPPAGG
FT                   VHSPVWQNCGFYEEPVRDENAVHSLEHGAVWITYRPDLPREQVERLRELARSQTYVLVS
FT                   PYPGLPAPVVASAWGKQLRLDSAEDGRLEQFVRAYRQGPQTPEPGAACTGGVGEPS"
     gtgaacggga ccaccgcccc ccgccgcctc cgtgctagca tctctggcgg cacgaagtcg        60
     tatacggccg agaggttcgg agcgttgggc aggatacgca gggagccccg cgggggcggg       120
     aggatgaacg cggtgtacct ggtcgccggg gggatagtgt tggcgctcat cgtggccttc       180
     gcggtcttcg ccgtcctgga cagccggcgc ggcggcgggg agatcgcggg ggtgaggagc       240
     tacgacgtgg gccccggcaa ccggcacacc cggggcgagg tggactacga gcagaccccg       300
     cccgcgggcg gggtgcacag ccccgtctgg cagaactgcg gcttctacga ggagccggtc       360
     cgggacgaga acgccgtcca ctcgctggag cacggggccg tctggatcac ctaccgcccc       420
     gacctgcccc gcgagcaggt cgagcggctc agggagctgg cccgcagcca gacctacgtc       480
     ctcgtgagcc cctaccccgg cctgcccgcg cccgtggtgg cctccgcctg gggcaagcag       540
     ctccggctgg actccgcgga agacgggcgc ctcgagcagt tcgtgcgggc ctaccggcag       600
     ggcccccaga cccccgagcc cggggccgcc tgcacagggg gcgtcgggga gccctcgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page