(data stored in ACNUC7421 zone)

EMBL: CP000386.PE587

CP000386.PE587       Location/Qualifiers
FT   CDS_pept        complement(626512..626940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0597"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   pab:PAB0452 virR related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03568"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG0"
FT                   /protein_id="ABG03568.1"
FT                   /translation="MSGRVELSPIGYVRTRPGRVPRSWTTSGVEGVLEVLPEYAEGLRD
FT                   LREGERILVVFHFHQSPPFGPEHLRQTPPHREGPVGVFSTCSPLRPNPVGVSVLEVLGV
FT                   EGRCVRVRGLDMLDGTPVLDIKPHVAADPSHPCRRERA"
     atgagcggga gggtggagct ctcccccatc gggtacgtcc ggacccgccc cgggcgggtg        60
     ccgcgcagct ggaccacctc cggggtggag ggggtgctcg aggtgctccc cgagtacgcg       120
     gaggggctgc gcgacctccg ggagggggag aggatcctgg tggtcttcca cttccaccag       180
     agcccgccct tcgggccgga gcacctgcgg cagaccccgc cgcaccggga ggggccggtc       240
     ggggtcttca gcacctgctc ccccctccgc cccaacccgg tgggcgtctc ggtgctggag       300
     gtgctcgggg tggaggggag atgcgtgcgg gtgagggggc tggacatgct ggacggcacg       360
     ccggtcctgg acatcaagcc gcacgtcgcc gccgacccct cccacccctg ccggcgggag       420
     agggcgtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page