(data stored in ACNUC7421 zone)

EMBL: CP000386.PE588

CP000386.PE588       Location/Qualifiers
FT   CDS_pept        complement(626937..627449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0598"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH1868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03569"
FT                   /db_xref="GOA:Q1AYF9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF9"
FT                   /protein_id="ABG03569.1"
FT                   /translation="MRELRTRRLRLRPFERKDLAALARIASEEETRGFLCDGERGPGEV
FT                   REALEGWLESYREGFGQLAMILQEGGRLIGHCGLERRGERAVLSYALHKDHWCRGLAPE
FT                   ACREVLRYGFEELGLEEVWTATRPENRAWRGMMERLGMGLREEGPGEVRYAVSRGAFLR
FT                   RPAAAGA"
     ttgagggagc tgaggacccg caggctgcgg ctgcggccgt tcgagagaaa ggatctcgcg        60
     gcgctcgccc ggatagcctc cgaggaggag acccggggct ttctgtgcga cggggagcga       120
     ggccccggcg aggtgaggga ggcgctggag ggctggctcg agagctaccg ggagggcttc       180
     gggcagctgg ccatgatcct gcaggagggc ggccggctca tcggccactg cgggctcgag       240
     cgccgggggg agcgggcggt gctctcctac gccctgcaca aagaccactg gtgcaggggg       300
     ctcgccccgg aggcctgccg ggaggtgctg cgctacggct tcgaggagct cgggctggag       360
     gaggtgtgga cggccacccg gccggagaac cgggcctggc gcgggatgat ggagcggctc       420
     gggatggggc tgcgggagga gggccccggg gaggtgcgct acgccgtctc gcgcggggcc       480
     ttcctccgcc ggcccgcggc ggcgggcgca tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page