(data stored in ACNUC7421 zone)

EMBL: CP000386.PE589

CP000386.PE589       Location/Qualifiers
FT   CDS_pept        complement(627473..627859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0599"
FT                   /product="transcriptional regulator, TrmB / transcriptional
FT                   regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, MarR regulatory protein,
FT                   ArsR transcriptional regulator TrmB; KEGG: nfa:nfa31050
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03570"
FT                   /db_xref="GOA:Q1AYF8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF8"
FT                   /protein_id="ABG03570.1"
FT                   /translation="MTHFRDAPAGERLLEPRDVLAGGPFPGVDERVAALMGALASPTRL
FT                   RALFALLESGELSAGELSKAVGMRPSATSHQLRVLRDLGLVRRRREGRRCYYSLADAHL
FT                   GVLLREALYHVDHARLGAARREER"
     atgacgcact tcagggacgc gccggcgggg gagcgcctgc tcgagccgcg ggacgtgctg        60
     gccgggggcc ccttccccgg ggtggacgag cgggtggcgg ccttgatggg ggctctggcg       120
     agccccaccc ggctgcgggc gctcttcgcg ctgctggaga gcggggagct ctcggccggg       180
     gagctctcca aggcggtggg gatgcgccct tcggcgacca gccaccagct gcgggtgctg       240
     agggatctgg ggctggtccg gcgccggagg gagggccgca ggtgctacta ctcgctcgcg       300
     gacgcccacc tcggggtgct gctgcgggag gcgctctacc acgtggacca cgcccggctc       360
     ggcgcggccc gcagggagga gcggtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page