(data stored in ACNUC7421 zone)

EMBL: CP000386.PE59

CP000386.PE59        Location/Qualifiers
FT   CDS_pept        60430..61908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0059"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: afu:AF1005
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03040"
FT                   /db_xref="GOA:Q1AZY8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY8"
FT                   /protein_id="ABG03040.1"
FT                   /translation="MGYLLRIKAVAAKELWVLVRQPQLLVMLLLGPVVIMVLFALSFRV
FT                   ENYLPWAVVVVEEGSEGEEIFREFRRQFVERTRFQGVLRSVERADRMLREGRTDAVIIL
FT                   PSDPSEAVAEGRQAVLEVHYQSINPLAGTAVPNRSNGLVLDLNRAIVREGIATELQNIS
FT                   GTVEEIEAINRQLERVSRAAEALTSERAREITSGLEEALSELEEALEGLEGRRAEEALE
FT                   RVRRARELLGELTSAQEAGARSIEERLGITELQRALDRLSEQVAEVPSGVPPRVLANPF
FT                   RLELENLAPFEPTAVEFYAPATLALLIQHVALSLASLAIVRERVSGAYEYFEVSPLRPG
FT                   GLLAGKFVTYLALVVAVNLAVAGVLAAVLEIPVRGGFALLAAAMAVLAAASVSAGFLLS
FT                   ALSRSQLQAIQVAMLVFIASGFFSGFLFPLRELEQPALAVSYFLPATYGIRALQEVMIL
FT                   GRWPAWGDLLGLAAIFCVSAACARLLLGRRGGAP"
     gtgggctacc tcctgaggat aaaggccgtc gcggccaagg agttatgggt gctcgtccgg        60
     cagccgcagc tgctggtgat gcttttgctg gggccggtgg tgatcatggt gctcttcgcc       120
     ctgagcttcc gggtggagaa ctacctgccg tgggcggtcg tggtggtcga ggaggggagc       180
     gagggggagg agatcttccg cgagttccgg cggcagttcg tggagcggac ccgctttcag       240
     ggggtgctcc gcagcgtgga gagggccgac cggatgctcc gggagggcag gaccgacgcg       300
     gtgatcatcc tgccctccga cccctccgag gcggtcgccg aggggcggca ggcggtgctg       360
     gaggtccact accagagcat caacccgctg gccggcaccg ccgtaccgaa ccgctccaac       420
     gggctggtgc tggacctcaa ccgggccatc gtgcgcgagg ggatcgccac cgagctgcag       480
     aacatcagcg ggacggtgga ggagatagag gccataaacc ggcagctgga gagggtgagc       540
     cgggcggcgg aggccctgac cagcgagagg gctcgcgaga taacctccgg gctggaggag       600
     gcgcttagcg agctggagga ggcgctggag ggcctggagg ggcggcgggc ggaggaggcg       660
     ctggagcgcg tgaggagggc ccgggagctg ctgggggagc tgacctcggc gcaggaggcg       720
     ggcgcgcgga gcatagagga gcggctgggg atcaccgagc tgcagcgggc gctcgaccgg       780
     ctctcggagc aggtggcgga ggtgccctcc ggggtgccgc cccgggttct tgcgaacccg       840
     ttccggctcg agctggagaa cctggcgccc ttcgagccca cggcggtcga gttctacgcc       900
     ccggcgaccc tcgcgctgct catccagcac gtcgccctca gcctggcctc gctggccatc       960
     gtccgcgagc gggtctccgg ggcctacgag tacttcgagg tttccccgct gcggccgggc      1020
     gggctgctcg cgggcaagtt cgtgacctac ctggcgctgg tggtggcggt gaacctcgcg      1080
     gtcgccggcg ttctggccgc cgtgctagag atcccggtgc ggggcggctt tgcgctgctt      1140
     gcggcggcca tggcggtgct ggcggcggcc tccgtctccg cgggctttct gctgtcggcg      1200
     ctctcccgca gccagctgca ggcgatacag gtcgcgatgc tcgtgttcat cgcgagcggc      1260
     ttcttctccg gctttctgtt ccccctgcgc gagctggagc agccggcgct cgcggtctcc      1320
     tacttcctgc ccgccaccta cggcataagg gctttgcagg aggtgatgat cctgggccgc      1380
     tggccggcct ggggggatct tctggggctg gcggcgatct tctgcgtctc ggcggcctgc      1440
     gcccgcctgc tgctgggccg caggggaggg gcgccgtga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page