(data stored in ACNUC7421 zone)

EMBL: CP000386.PE592

CP000386.PE592       Location/Qualifiers
FT   CDS_pept        629697..630053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03573"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF5"
FT                   /protein_id="ABG03573.1"
FT                   /translation="MYPQGVGAETGTKRFPAELARAGEARHHIAWLAAAAGLRGEALHG
FT                   LAVAAEALLTDVLLGSDGGVMEVFARSEGGLLRIEISHPTATGRVRGLEAVLERFLDGH
FT                   ELSPERSVLVKRLG"
     ttgtaccctc aaggggtggg cgcagagacc gggacaaagc gcttccccgc cgagctcgcc        60
     cgcgccgggg aggcccggca ccacatcgcc tggctcgccg ccgccgccgg gctgcgcggg       120
     gaggcgctgc acgggctcgc cgtcgccgcc gaggcgctcc tcaccgacgt gctgctcggc       180
     tccgacgggg gggtgatgga ggtctttgcc cgcagcgagg gcgggctgct caggatcgag       240
     atctcccacc caacggccac gggccgggtg cgcggcctcg aggcggtgct ggagcgcttt       300
     ctggacgggc acgagctctc ccccgaaagg agcgtgctgg tcaagcgcct gggctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page