(data stored in ACNUC7421 zone)

EMBL: CP000386.PE594

CP000386.PE594       Location/Qualifiers
FT   CDS_pept        complement(630352..631794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0604"
FT                   /product="oxidoreductase/nitrogenase, component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase, component 1; KEGG:
FT                   cte:CT2151 protochlorophyllide reductase, ChlB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03575"
FT                   /db_xref="GOA:Q1AYF3"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF3"
FT                   /protein_id="ABG03575.1"
FT                   /translation="MRLLRGVYEGPSAHGILHLAASVRGAQAVLRALPGENYFPAFYAD
FT                   RRRDGSLPPLTLSPMWRRPDDTRAPGELQRDLLRAAGRDGGVRNVLLARSEAALLSGEE
FT                   PPGELTLPPHPETGRSPRLLPCGWQVPGMGETEAAELALEDLVRAHAAPQPRTAEPTAN
FT                   LFGPLALGRDAEAEYAEAERLLGLMGVGVNARVPLGAGEEELSRLTRAWVNVVLYREVA
FT                   ESATLYLQDEFGIPRVTTPMVGTSGTGAALRAAARVCELEARTVRQAIWGELSRTAKLP
FT                   WYARLAPPEVFEDKSVFIFGDFTYALGLGYALSREVGLRVAGCGTYLTHLARDFAFHAS
FT                   TFTDAAFASDDPEEVARRIEGAAPDLLVGTELEREVAGSLGIPFLPFCPPAGERSFAPR
FT                   PLMGYAGSSVLADALDGALRRVEEPREEAGPPEIPWTEEALEELAGVPVFLRGRARRLA
FT                   EERARELGSPEVTRAIFLESRL"
     atgaggctgc tgcggggcgt ctacgagggg ccgtccgcgc acggcatcct ccacctggcg        60
     gcgagcgttc ggggggcgca ggcggtgctg cgcgccctgc ccggcgagaa ctacttcccc       120
     gccttctacg ccgaccgccg gcgcgacggc tcgctgcccc cgctgacgct cagcccgatg       180
     tggcggcgcc cggacgacac ccgggcgccg ggggagctgc agcgggacct gctgcgggcc       240
     gctggccgcg acgggggggt cagaaacgtc ctgctcgccc gctcggaggc ggcgctgctc       300
     tcgggcgagg agccgcccgg ggagctcacc ctccccccgc acccggagac gggccggagc       360
     ccgcgcctcc tcccctgcgg ctggcaggtt ccggggatgg gcgagacgga ggccgcggag       420
     ctggcgctcg aggatctggt gcgggcccac gccgcccccc agccgcgcac cgccgagccc       480
     acggcgaacc tcttcggccc gctcgcgctg ggccgggacg ccgaggccga gtacgccgag       540
     gccgagcggc tgctgggcct gatgggggtg ggggtcaacg cccgggtgcc gctgggggcg       600
     ggggaggagg agctctcgcg cctgacccgg gcctgggtca acgtggtcct ctaccgggag       660
     gtggccgagt cggcgacgct ctacctgcag gacgagttcg gcatcccgcg ggtcaccacc       720
     cccatggtgg ggacgtcggg gaccggggcg gcgctgcggg cggcggcccg ggtgtgcgag       780
     ctggaggcca ggacggtgcg gcaggctatc tggggcgagc tctcgcgcac ggcgaagctg       840
     ccgtggtacg cgcggctggc cccgccggag gtcttcgagg acaagagcgt cttcatcttc       900
     ggggacttca cctacgcgct ggggctgggc tacgcgctct cgcgggaggt ggggctccgg       960
     gtggcgggct gcggcaccta cctcacccac ctggcccgcg acttcgcgtt ccacgccagc      1020
     accttcaccg acgccgcctt cgcctccgac gaccccgagg aggtggcccg gaggatcgag      1080
     ggcgccgccc ccgacctgct ggtggggacg gagctggaga gggaggtcgc cgggtcgctg      1140
     gggatcccgt tcctcccctt ctgcccgccc gcgggcgagc gctccttcgc cccgcggccg      1200
     ctgatgggct acgcgggctc gagcgtgctg gccgacgcgc tggacggggc gctccggcgg      1260
     gtggaggagc cccgggagga ggccgggccg ccggagatcc cgtggacgga ggaggcgctg      1320
     gaggagctgg ccggggtgcc ggtgttcttg cgggggaggg cgcggcggct ggcggaggag      1380
     cgggcgcggg agctgggctc cccggaggtg acgcgcgcca tctttctgga gtcccgcctc      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page