(data stored in ACNUC7421 zone)

EMBL: CP000386.PE60

CP000386.PE60        Location/Qualifiers
FT   CDS_pept        61914..62852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   gme:Gmet_0657 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03041"
FT                   /db_xref="GOA:Q1AZY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY7"
FT                   /protein_id="ABG03041.1"
FT                   /translation="MIEAEGLGMSFGGEEVLGEIYLSVGEGEIFGLIGPSGAGKSTLTR
FT                   LLTGYLRPSRGSVRVFGRDPCAFGAADRRRIGFMPQGFVLYGGLSVRQNVNFAAGLYGL
FT                   RLGERRRRVREVLEFTELWKDRRKAASRLSGGMQRRLQLAAALVHEPQLLFVDEPTANL
FT                   DPILRRKFWEGFEVLRDMGRTIFVTTQYVGEAELCDRVGLLSGGGLAAVGTPEELRRRA
FT                   FGGEAMELTLAGEPGRLGRHLDALEGVGHVVEVREERPGDGAAASTVRLVVEDADTALP
FT                   RAFEALRGAEVLSADLIHPSFDEVFVRLVRG"
     gtgatcgagg cggaggggct gggcatgagc ttcggcggcg aggaggtgct cggggagatc        60
     tacctgtccg tgggggaggg ggagatcttc gggctcatcg gaccctcggg ggcggggaag       120
     agcaccctga cccgcctgct caccggctac ctcaggccct cccgggggag cgtgcgggtc       180
     ttcgggcggg acccctgcgc cttcggcgcg gcggaccgcc gcaggatcgg ctttatgccc       240
     caggggttcg tgctgtacgg ggggctctcc gtgcggcaga acgtgaactt cgccgccggg       300
     ctctacgggc tgcggctggg agaaagaagg cgtcgggtgc gcgaggtgct ggagttcacc       360
     gagctgtgga aggaccggcg caaggcggcc tccaggctct ccggggggat gcagcggcgg       420
     ctgcagctcg ccgccgcgct ggtgcacgag ccgcagctgc tgttcgtgga cgagccgacg       480
     gccaacctgg acccgatcct ccgccgcaag ttctgggagg gcttcgaggt gctgcgcgac       540
     atggggcgca cgatcttcgt caccacccag tacgtgggcg aggcggagct gtgcgaccgg       600
     gtgggcctgc tctcgggcgg cggcctcgcc gcggtcggca ccccggagga gctgcgccgg       660
     cgggcgttcg gcggcgaggc gatggagctg acgctcgcgg gcgaacccgg caggctcggc       720
     cggcacctgg acgccctcga gggggtgggg cacgtggtcg aggtgcggga ggagaggccc       780
     ggggacggcg cggcggcgag caccgtgcgg ctggtggtgg aggacgccga caccgccctg       840
     ccccgcgcct tcgaggccct gcgcggggcc gaggtgctgt ccgcggacct catccacccc       900
     tccttcgacg aggtctttgt gcggctggtg cgcggctag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page