(data stored in ACNUC7421 zone)

EMBL: CP000386.PE61

CP000386.PE61        Location/Qualifiers
FT   CDS_pept        62882..64033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0061"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bce:BC4385 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03042"
FT                   /db_xref="GOA:Q1AZY6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY6"
FT                   /protein_id="ABG03042.1"
FT                   /translation="MGIWRWSGRKKEGARRAPAASGGRRAPTPIYVSRRTFTALVALAL
FT                   LSLGVVLYLAPIIFEILFGGIALALVLSYPVRALSQVMPRELAILVTVLGLFGLVALAL
FT                   LFLIPLLIEQLTNFVRITPAIAASATEFFGSLDDLLNRRDLPLQLPESFVSDLVRDLFD
FT                   RAQQILEGMIRNLIGFISGAFSFAVGVLGVLFVAIYLLIDVRKVKAAYLRMVPHRYRWD
FT                   ARELWDAFGVSLSRYLGGLLFVVAVQGALSAAALWVLGVPYPILLGAWVSVTAIVPYLG
FT                   PFLGAIPAIIVALIFTTPTTAVLTVIAYIAIQQFEGNFLTPRIQGRALQVHPIIVLLAV
FT                   IGGGQIAGIVGILFAVPVLAILRVFVDFFRVRLRVGPPPRNAA"
     atgggcatct ggcgctggtc cgggagaaag aaggagggag cgcgccgcgc ccccgccgcc        60
     tccggggggc gccgcgcccc cacccccatc tacgtctcgc ggaggacgtt caccgccctg       120
     gtggcgctcg cgctgctctc cttgggcgtc gtcctgtacc tcgccccgat catcttcgag       180
     atcctcttcg gcggcatagc gctcgccctc gtgctctcct acccggtgcg ggcgctctcg       240
     caggtgatgc cgcgggagct ggccatcctg gtcaccgtgc tggggctctt cgggctggtg       300
     gccctggcgc tgctgttcct gatcccgctg ctcatagagc agctcacgaa cttcgtgcgg       360
     atcacgccgg ccatagccgc gagcgccacg gagttcttcg gctcgctgga cgacctgctg       420
     aaccggcggg acctgccgct gcagctgccg gagagcttcg tctcggatct ggtgcgggac       480
     ctcttcgacc gggcccagca gatcctggag ggcatgatcc ggaacctgat cgggttcatc       540
     tccggggcgt tcagctttgc ggtgggggtg ctcggcgtgc tcttcgtggc gatctacctg       600
     ctcatagacg tgcggaaggt caaggccgcg tacctgcgga tggtcccgca ccgctaccgc       660
     tgggacgccc gcgagctgtg ggacgccttc ggggtctcgc tctcgcgcta cctgggcggg       720
     ctgctcttcg tggtggcggt gcagggggcc ctctcggcgg cggcgctctg ggtgctgggg       780
     gtgccctacc cgatcctgct cggcgcctgg gtctcggtga cggccatagt cccctacctg       840
     gggccgtttc tgggggccat cccggcgatc atcgtggccc tgatcttcac cacccccacc       900
     acggcggtgc tgacggtgat cgcctacatc gcgatccagc agttcgaggg gaacttcctg       960
     acgccgagga tccagggccg cgcgctgcag gtgcacccga tcatcgtgct gctggcggtg      1020
     atcgggggcg gccagatcgc cggcatcgtg ggcatcctgt tcgccgtgcc ggtgctggcg      1080
     atcctgcggg tcttcgtgga ctttttccgg gtccggctgc gggtcggccc tcccccgcga      1140
     aacgccgcct ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page