(data stored in ACNUC7421 zone)

EMBL: CP000386.PE64

CP000386.PE64        Location/Qualifiers
FT   CDS_pept        66314..67048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03045"
FT                   /db_xref="GOA:Q1AZY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY3"
FT                   /protein_id="ABG03045.1"
FT                   /translation="MRALQNAGWIAGWEMRRAWLSYPLSAALLSFFGVVGAHFADEALA
FT                   GPGGAGAAFRVFYLDFFFLAATSLLAGNFFSRDYALSWGDTFSRRLAFLRRLPVSPGEI
FT                   VAGRVLSMLAAAVINVPLFFLALYALSGALGGLLEGTERVWFAGLWFGAALAWGGLYLY
FT                   LETGTSGRVYNLLMFPLIALFAVLAGVAQGVFGLRVVELAAAAAREGGPLAAAGAVLLG
FT                   AAVLAAMARAAARRVGRRELLA"
     atgcgcgcgc tgcaaaacgc cgggtggatc gccgggtggg agatgaggag ggcctggctc        60
     tcctacccgc tttcggcggc gctgctgtcc ttcttcgggg tggtgggcgc gcacttcgcg       120
     gacgaggcgc tcgcgggtcc gggaggggca ggggccgcct tcagggtctt ctatctggac       180
     ttcttctttc tcgctgcaac ctccctgctc gcgggcaact tcttctcgcg ggactacgcg       240
     ctctcctggg gggacacctt ctccaggagg ctcgcctttc tgcggcgcct gcccgtctcg       300
     cccggggaga tagtggccgg gagggtgctc tcgatgctcg ccgccgccgt catcaacgtg       360
     ccgctgttct tcctcgccct ctacgcgctc tccggggcgc tgggcgggct gctcgagggg       420
     acggagcgcg tgtggttcgc ggggctgtgg ttcggggcgg cgctcgcctg gggcgggctg       480
     tacctgtacc tggagaccgg aacctccggc agggtctaca acctgctcat gtttcccctg       540
     atagccctct tcgccgtcct tgccggggtc gctcaggggg tgttcggcct gcgggtggtg       600
     gagctcgcgg ccgcggcggc gcgggagggc gggccgctcg cggcggcggg cgccgtcctc       660
     ctcggggcgg ccgtcctcgc cgccatggca cgggccgccg cgcgccgggt gggccggagg       720
     gagctcctcg cgtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page