(data stored in ACNUC7421 zone)

EMBL: CP000386.PE65

CP000386.PE65        Location/Qualifiers
FT   CDS_pept        67084..67470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0065"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG: bha:BH1164
FT                   transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03046"
FT                   /db_xref="GOA:Q1AZY2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY2"
FT                   /protein_id="ABG03046.1"
FT                   /translation="MEDPEPMYRQIEGQLRKLILGGHLPPGTRLPPVRALAQDLSCSVI
FT                   TTRRAYQDLEAEGLVRTRQGLGTVVAEIGEEERARHRRSAVLAAFREAVESGLRAGCSP
FT                   GELYEIFEQAVRQQTKRRDEDEAV"
     atggaagatc cggagcccat gtaccggcag atagagggcc agctgcgaaa gctcatcctg        60
     ggcggccatc tcccccccgg gaccaggctg cccccggtgc gggctctggc gcaggatctc       120
     tcctgcagcg tcatcaccac ccggcgggcc taccaggatc tggaggcgga gggtcttgtc       180
     cggacccgcc aggggctcgg gaccgtggtg gccgagatcg gtgaggagga gcgcgcccgg       240
     caccgccgct ctgcggtgct cgccgccttc cgggaggcgg tggagagcgg gctgcgcgcc       300
     gggtgctcgc ccggagagct ctacgagatc ttcgagcagg ccgtgcggca acagacgaag       360
     aggagggacg aggatgaggc ggtgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page