(data stored in ACNUC7421 zone)

EMBL: CP000386.PE67

CP000386.PE67        Location/Qualifiers
FT   CDS_pept        complement(68373..69221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0067"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00567 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03048"
FT                   /db_xref="GOA:Q1AZY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY0"
FT                   /protein_id="ABG03048.1"
FT                   /translation="MLGSKARAERLTRAGLYAAYAAITAFFLFPIFWVVSMSLKTVPQL
FT                   FASPPVWFPVPPQFENYAYVLTGTSIGRYLLNSAFIVLMTVIFTLIIATLAAYGFSRFS
FT                   FRYKRPSLLAVLVFQMVSPVVIAIPLYRFFAALGLLNSYATLILVYVAIVLPFTTWFLK
FT                   GYFDTIPYEMDEAAIVDGASRWQVLTRILLPVCAPGIATAAILAAVLSWSQFVVPFILL
FT                   DSRELYPISVGLVDLKNTSDAITLHYLSAASVIAIAPVIAVFVLLQRYIVNALTAGAIK
FT                   G"
     gtgctcggca gcaaggcgcg ggcggagcgg ctgacgcggg cggggctcta cgcggcctac        60
     gcggcgatca ccgcgttctt cctgttcccc atcttctggg tggtctcgat gtcgctgaag       120
     acggtgccgc agctcttcgc cagcccgccg gtgtggttcc ccgtcccccc gcagttcgaa       180
     aactacgcgt acgtgctcac cggcacctcc atcgggcgct acctcctgaa ctcggcgttc       240
     atcgtgctga tgacggtgat cttcaccctc atcatcgcca ccctggcggc ctacggcttc       300
     agccggttct ccttccgcta caagcggccc tcgctgctgg cggtgctggt cttccagatg       360
     gtctcgccgg tggtgatagc gatcccgctc taccgcttct tcgcggccct ggggctgctg       420
     aacagctacg cgaccctcat actggtgtac gtggcgatcg tgctgccgtt caccacctgg       480
     tttctgaagg gctacttcga cacgatcccc tacgagatgg acgaggcggc catcgtggac       540
     ggcgcgagcc gctggcaggt gctcaccagg atcctgctcc cggtgtgcgc ccccggcatc       600
     gccacggcgg ctatcctggc ggcggtgctc tcctggtcgc agttcgtggt gccgttcatc       660
     ctgctggaca gccgggagct gtacccgatc tcggtgggcc tggtggacct gaagaacacc       720
     tcggacgcga taacgctgca ctacctctcg gcggcgagcg tgatcgcgat agccccggtg       780
     atcgcggtct tcgtgctgct gcagcggtac atcgtgaacg ccctgacggc cggggcgatc       840
     aagggctag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page