(data stored in ACNUC7421 zone)

EMBL: CP000386.PE71

CP000386.PE71        Location/Qualifiers
FT   CDS_pept        complement(74263..74601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03052"
FT                   /db_xref="GOA:Q1AZX6"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX6"
FT                   /protein_id="ABG03052.1"
FT                   /translation="MTSRREEILERLGGSRLFAAVASRVAPPVDRALYRRLGGRTLGAG
FT                   PQTLLLTTRRRSSGRMRTVPLLYVRDGERLAVAASNWGRKVPSRNASHARISPKAREIG
FT                   EASRSMEG"
     atgacctcgc gcagagaaga gatcctggag aggctcggcg gcagccgcct cttcgccgcc        60
     gtggcctcca gggtggcccc gccggtggac cgtgcgctct accggcggct ggggggcagg       120
     acgctcggcg ccggcccaca aaccctgctg ctcaccaccc gccgcaggag ctccggcagg       180
     atgcggaccg tacccctgct gtacgtgcgg gacggggagc ggctggcggt cgccgcgagc       240
     aactgggggc gcaaagtccc gtcgcgaaac gcctcccatg ctaggataag ccccaaggca       300
     agagagatag gggaagcgtc ccgaagcatg gaaggatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page