(data stored in ACNUC7421 zone)

EMBL: CP000386.PE74

CP000386.PE74        Location/Qualifiers
FT   CDS_pept        complement(77177..78394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0074"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase aminotransferase, class I and II;
FT                   KEGG: ade:Adeh_3830 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03055"
FT                   /db_xref="GOA:Q1AZX3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019877"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX3"
FT                   /protein_id="ABG03055.1"
FT                   /translation="MVYFWPAAEENRPLGGLYPVRKADATPLRLNPVLERQGEYPLLRL
FT                   DERRERLKEQGVRLFDFGAGDPREPTDPRIRRALLEAVPEVSQYPSASGTRALREAFCG
FT                   WMERRHGVELDPDAEVLPASGSKEAIFHAHLPFLHHTHERRGVAYGTPGYPVYERGALF
FT                   AGGEALPVRLVREDGFLLPLEAVDPQRTRILWLNYPHNPTGARAPRSYLEEAAAFCREH
FT                   DILLFSDECYNEIYSGDPPPSVLEVSRERTLAFCSLSKRSGMTGYRSAMMAGDAELISA
FT                   LGKLRPSVGVASPSFVQAAAAAAWSDDEHVEERRRTFARKRGLFVEFFRRAGLDFLPTD
FT                   ATFYLWVAVPGGDDEAYALRLLEEGIVVAPGRSFGPGGEGYVRVALVPSLEECEEAVRR
FT                   WEALAA"
     atggtatatt tctggccggc agcggaagag aaccgacccc tagggggact ataccctgtg        60
     agaaaagccg acgcgacccc tctccggctc aacccggtcc tcgagcggca gggagagtac       120
     ccgctcctgc gcctcgacga gcggcgcgag cggctgaaag agcagggcgt ccggctcttc       180
     gacttcggcg cgggcgaccc gcgggagccc acggacccca ggatccggcg ggccctcctc       240
     gaggcggtcc ccgaggtgag ccagtacccc agcgcctccg gaacgcgcgc cctgcgcgag       300
     gccttctgcg gctggatgga gcggcggcac ggggtggagc tggaccccga cgccgaggtg       360
     ctcccggcct ccggctccaa agaggccatc ttccacgccc acctgccctt cctgcaccac       420
     acccacgagc ggcgcggggt agcctacggc acccccggct accccgtcta cgagcggggg       480
     gcgctgttcg ccggggggga ggcgctcccc gtgcggctcg ttcgcgagga cggctttctg       540
     ctccccctcg aggccgtgga cccgcagagg acccgcatcc tgtggctcaa ctacccccac       600
     aaccccaccg gggcccgggc gccgcgctcc tacctcgagg aggcggccgc cttctgtcgg       660
     gagcacgaca tcctgctctt ctccgacgag tgctacaacg agatctactc cggcgacccg       720
     ccgccctcgg tgctggaggt gagccgggag cgcaccctcg ccttctgttc cctctccaag       780
     cgcagcggca tgaccggcta ccgctcggcc atgatggccg gggacgccga gctcatctcc       840
     gccctcggga agctgcgccc ctcggtgggg gtggcctccc cctcctttgt ccaggcggcg       900
     gccgccgccg cctggtccga cgacgagcac gtcgaggagc gccgccgcac cttcgccaga       960
     aagcgggggc tcttcgtgga gttcttccgg cgtgcggggc tggacttcct gcccaccgac      1020
     gccaccttct acctctgggt ggccgtcccg ggcggcgacg acgaggccta cgccctccgg      1080
     ctgctggagg agggcatcgt ggtggccccg gggaggtcct tcggccccgg cggcgagggg      1140
     tacgtccgcg tggcgctcgt cccctccctc gaggagtgcg aggaggccgt gcggcggtgg      1200
     gaggccctgg cggcctag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page