(data stored in ACNUC7421 zone)

EMBL: CP000386.PE78

CP000386.PE78        Location/Qualifiers
FT   CDS_pept        81997..82953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0078"
FT                   /product="PfkB"
FT                   /note="PFAM: PfkB; KEGG: bcl:ABC3352
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03059"
FT                   /db_xref="GOA:Q1AZW9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW9"
FT                   /protein_id="ABG03059.1"
FT                   /translation="MEASGALEVVTLGEALIVMDPVERGPLRHVPGFRKRVGGAELNVA
FT                   VALARLGHRAGWAGSVGDDEFGREVLGFLRAEGVDVSGAVLDPGAPTGLYFKEWRAGGL
FT                   RAHYYRAGSAASRMAPGRLDEGFLLSGRVLHLTGITPALSGGCEELVRRLAGEAGRRGV
FT                   LLSFDANIRWRLFGERDPRKAIEPLLPLADLLFLSDEEAELLLGGSDPRSVERARGRLG
FT                   AGVVVVHSASGSFAAGGEGVVRREGYRVEAVDTVGAGDAFVGGFLAGFLRGWETGACLE
FT                   LANACGACAVAVPGDAASMPAEEEALALLRGRRERER"
     ttggaggcgt ccggcgcgct ggaggtggtg acgctcggcg aggcgctcat cgtcatggac        60
     cccgtcgagc gggggccgct gcggcacgtg cccggcttcc gcaagcgggt gggcggggcc       120
     gagctgaacg tggcggtggc cctcgcccgg ctgggtcacc gggcgggctg ggcgggctct       180
     gtgggcgacg acgagttcgg ccgggaggtg ctcggctttc tgcgggccga gggggtggac       240
     gtctcggggg cggtgctgga ccccggggcg cccaccgggc tgtacttcaa ggagtggcgg       300
     gcggggggtc tcagggccca ctactaccgg gccgggtcgg cggcgagccg gatggccccc       360
     gggaggttgg acgaggggtt cctgctctcc gggagggtgc tgcacctcac cgggatcacg       420
     ccggccctct ccgggggctg cgaggagctg gtgcggcgtc tggcggggga ggcgggccgg       480
     cggggagtgc tcctctcctt cgacgccaac atccgctggc ggctcttcgg ggagcgggac       540
     ccgcggaagg cgatcgaacc gctcctcccg ctggcggacc tgctctttct ctccgacgag       600
     gaggcggagc tgctgctcgg ggggagcgac ccgcggagcg tggagcgggc ccgcgggcgg       660
     ctcggggcgg gcgtggtggt cgtgcactcc gcctccggct cgttcgccgc cggcggggag       720
     ggcgtggtcc ggagggaggg ctacagggtg gaggccgtgg acaccgtggg ggcgggtgac       780
     gccttcgtgg ggggctttct cgccggcttt ctgcggggct gggagaccgg ggcgtgcctg       840
     gagctggcca acgcctgcgg ggcgtgcgcg gtagccgtgc cgggggacgc ggccagcatg       900
     cccgcggagg aggaggcgct ggcgctcctg cgcggccgcc gggagcggga acgttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page