(data stored in ACNUC7421 zone)

EMBL: CP000386.PE87

CP000386.PE87        Location/Qualifiers
FT   CDS_pept        91359..91835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0088"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: ttj:TTHA0953
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03068"
FT                   /db_xref="GOA:Q1AZW0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW0"
FT                   /protein_id="ABG03068.1"
FT                   /translation="MEEEKLAYIEEFGLFFERVGGSRMVGRVLAALLVSEPPELTAGEL
FT                   AEILRASRGSISTATRTLEQMGMVRRFARPGERRDYFRVRPHAWEETVRRQSAMLSRFV
FT                   ALAERGIELLDPKTPDARRSLEEMRDFYAFWEGEVGRVMELWEREKRGRREVAG"
     gtggaggaag agaagctcgc gtacatcgag gagttcgggc tcttcttcga gcgggtgggc        60
     ggctcgcgga tggtgggccg ggtgctggcg gcgctgctgg tctcggagcc gcccgagctg       120
     acggcggggg agcttgctga gatcctgcgg gccagccggg gttccataag cacggcgacg       180
     cgcacgctgg agcagatggg gatggtgcgg cggttcgcca ggcccggcga gcggcgcgac       240
     tacttccggg tgaggccgca cgcctgggag gagacggtgc ggcggcagtc cgcgatgctc       300
     tcccggttcg tggcgctggc ggagaggggc atcgagcttc tggaccccaa gacgccggac       360
     gcccgccgca gcctggagga gatgcgcgac ttctacgcct tctgggaggg agaggtgggg       420
     cgcgtcatgg agctctggga gcgggagaag cgcgggcggc gggaggttgc cgggtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page