(data stored in ACNUC7421 zone)

EMBL: CP000386.PE88

CP000386.PE88        Location/Qualifiers
FT   CDS_pept        91874..92797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0089"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   tma:TM1028 putative ABC-2 type transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03069"
FT                   /db_xref="GOA:Q1AZV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV9"
FT                   /protein_id="ABG03069.1"
FT                   /translation="MRREMGAVIETSGLAKSYGKSRGIRGVDLTVREGEVFGFLGPNGA
FT                   GKTTTIRLLMGFLRPSGGSARVFGFDVWRQSVEVRSRVGNLPGEFALEDRLTGEELLRF
FT                   FARLRGVGDLSHARELAERLGAELGRPMRRLSRGNKQKIGLIQAMFHRPPLLILDEPTG
FT                   GLDPLVQEEFLGMVREVKEEGRTVFFSSHNLAEVERVCDRVGIIREGELVAVEPTDALI
FT                   DKSFRHVRVAFGEEPPEKELRRLAGLPGVENFRSEGPGRVSFTVYGGFDAVIKQLARHT
FT                   VAGVDFERPSLEEVFLAYYGGKGDGR"
     ttgcggaggg agatgggtgc ggtcatcgag accagcgggc tcgccaagag ctacggcaag        60
     agccgcggga tccggggcgt ggacctcacc gtccgggagg gcgaggtctt cggcttcctc       120
     gggcccaacg gggccgggaa gaccaccacc atccggctgc tcatgggctt tctgcggccc       180
     agcggcggca gcgcccgggt cttcgggttc gacgtctgga ggcagagcgt cgaggtgcgc       240
     tcccgggtgg gcaacctgcc cggcgagttc gcgcttgagg accggctgac cggcgaggag       300
     ctgctgcgct tcttcgcccg gctgcgcggg gtgggggacc tctcccacgc gcgcgagctc       360
     gcggagaggc tcggggccga gctggggcgc cccatgcgca ggctcagcag ggggaacaag       420
     cagaagatcg ggctcataca ggccatgttc caccggccgc cgctcctgat cctggacgag       480
     cctacgggcg gcctcgaccc gctggtgcag gaggagttcc tggggatggt gcgggaggtg       540
     aaggaggagg ggcgcaccgt cttcttctcc tcgcacaacc tggccgaggt cgagcgggtg       600
     tgcgaccggg tcgggatcat ccgcgagggc gagctggtgg cggtggagcc caccgacgcc       660
     ctgatcgaca agtccttccg gcacgtgcgg gtggccttcg gggaggagcc cccggagaag       720
     gagctgcggc gcctcgcggg ccttccgggc gtcgagaact tccggtcgga gggtcccggg       780
     cgcgtctcct tcaccgtgta cgggggcttc gacgccgtga taaagcagct ggcccgccac       840
     acggtggcgg gcgtggactt cgagcgcccg agcctagagg aggtctttct cgcctactac       900
     ggcgggaagg gggatgggcg gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page