(data stored in ACNUC7421 zone)

EMBL: CP000386.PE9

CP000386.PE9         Location/Qualifiers
FT   CDS_pept        10952..11329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B038"
FT                   /protein_id="ABG02990.1"
FT                   /translation="MGINQRVSLRKFRDDIERWVEEGRSDEWIASALGTSASSVQSFRS
FT                   RNGIYRRSAAPALRDPEDYAAYEGVVERGERIGLWFDPQVQDDPRWKEGWSGAERVEIR
FT                   LTPRKIVLRRRPGASGSGSKV"
     atgggtataa accagcgggt atcgctcaga aaattcaggg acgacatcga gcgctgggtc        60
     gaggagggcc gcagcgacga gtggatagcg agcgctcttg ggacgagcgc ttcttcggtc       120
     cagtccttcc gctcgcgcaa cggcatctac cggcgcagcg ccgctcccgc gctgcgggac       180
     ccggaggact acgccgccta tgagggggtc gtggagcgcg gcgagaggat cgggctgtgg       240
     ttcgaccccc aggtacagga tgacccccgc tggaaggagg gctggagcgg ggcggagcgc       300
     gtggagatcc gcctgacgcc gaggaagatc gtcctccgcc gcaggcccgg ggcctccggg       360
     tccggctcta aagtataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page