(data stored in SCRATCH zone)

EMBL: CP000423.PE105

CP000423.PE105       Location/Qualifiers
FT   CDS_pept        101336..101923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0107"
FT                   /product="Phospholipase A2 family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68971"
FT                   /db_xref="GOA:Q03CV1"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CV1"
FT                   /protein_id="ABJ68971.1"
FT                   /translation="MKFSKRSKRFDIIRRSAVIVFALISMTLFFQFNSGVEVHATTKTE
FT                   FNDTEINRETSEQLKMIDPYLKNVDGITSFDYDAAMNDNVDPVVLKIGAEINKWARSLK
FT                   NDGPEKGMLFSMARFNLLVYGNYCGKGNNGKAPIDDLDGACQAHDTCYAWGGNNEKCNQ
FT                   EFRQRLLTIMQETSLFDYKHIVAVAAYKLFGG"
     atgaaattct ctaaacgctc aaaacgattt gatataatca ggcgaagtgc cgtaatagtt        60
     tttgcgctga tcagtatgac actatttttt caatttaata gtggggttga ggtccacgca       120
     acgactaaga ctgagtttaa tgacactgaa atcaacagag aaacaagtga acaattaaaa       180
     atgatcgatc cgtacttaaa gaatgttgat ggtatcacaa gttttgacta tgatgctgcc       240
     atgaatgaca atgtcgatcc cgttgtccta aaaattggcg cagaaataaa taaatgggct       300
     cgcagcctta aaaatgatgg tccagaaaaa ggtatgctat tctcaatggc cagatttaat       360
     ttattggtgt atgggaatta ttgcggtaaa ggcaacaacg gcaaagcacc gattgatgat       420
     cttgatggcg catgccaagc acatgataca tgttatgcgt ggggcgggaa caatgagaag       480
     tgtaatcaag aatttcgtca acgcttatta acaattatgc aggagacatc gctttttgat       540
     tacaagcaca ttgttgccgt tgctgcatat aaactgtttg gtggttga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page