(data stored in SCRATCH zone)

EMBL: CP000423.PE106

CP000423.PE106       Location/Qualifiers
FT   CDS_pept        102009..102308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68972"
FT                   /db_xref="GOA:Q03CV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CV0"
FT                   /protein_id="ABJ68972.1"
FT                   /translation="MKAKSKIAIGNVGILTVIFALMTIITFSGIKNFVGIELGTGFIGL
FT                   LVIALLIICWQIYLLLEKSALGWSFNIIIGVYTLVVGAAISFIASFFIGFALFP"
     atgaaagcta aatcgaaaat cgccattggt aatgtcggta tcttgactgt catatttgcc        60
     ttaatgacca tcataacttt ctctggaata aagaacttcg ttggcatcga gcttggcaca       120
     gggttcattg ggctattagt gattgccttg ctgattatct gctggcaaat ttacctttta       180
     ttagaaaagt cagctcttgg ctggagcttt aatattatca tcggtgttta cacattggtt       240
     gttggagcag ccatctcttt cattgcctca tttttcattg gttttgcgct attcccttga       300
//

If you have problems or comments...

PBIL Back to PBIL home page