(data stored in SCRATCH zone)

EMBL: CP000423.PE110

CP000423.PE110       Location/Qualifiers
FT   CDS_pept        complement(105754..105951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68976"
FT                   /db_xref="GOA:Q03CU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CU6"
FT                   /protein_id="ABJ68976.1"
FT                   /translation="MTIFGKKIAAIADMSPIAKMADSFFGIIYDHNFHELSSTIGILLL
FT                   GSFIFLVIIHVMYRPEKFEG"
     atgactattt ttggcaaaaa aattgctgca atcgctgata tgtcacccat tgccaaaatg        60
     gcggatagct tttttggcat catttatgat cataattttc acgaactctc cagtaccatc       120
     ggcatactgt tattgggttc gtttatcttc ttagtgatta ttcatgtgat gtatcgtccg       180
     gaaaaattcg agggataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page