(data stored in SCRATCH zone)

EMBL: CP000423.PE111

CP000423.PE111       Location/Qualifiers
FT   CDS_pept        complement(105967..106494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68977"
FT                   /db_xref="GOA:Q03CU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CU5"
FT                   /protein_id="ABJ68977.1"
FT                   /translation="MLTIMHQDILTLLKNKPIMIYLVLYPPLLILVTGFVFSGIFSDDV
FT                   LTSYDYYGVTMMIYLSMATVIILPEMLFGSHVKYANYRIIYAPIARAKVYLSKLLVSIG
FT                   FAYIIMAAYMLLFNTIGLVDFGGKNIGGLLLLDLVFVIFAITFGGAFCVIIRNEDLSTN
FT                   LLNLLINVFAIA"
     atgctcacga tcatgcatca agatattttg acgcttttga aaaacaaacc aattatgatt        60
     tatctagtgc tttacccgcc tttactcatt ttggtaacag gctttgtctt tagtggtatc       120
     ttcagcgatg atgttttgac ctcgtatgac tattatgggg tcactatgat gatttatctg       180
     tcgatggcaa cggtcatcat cttgccggaa atgctttttg gcagccatgt aaaatacgcc       240
     aattatcgga ttatttatgc acccattgcg cgtgcaaaag tctacttatc caaattgctg       300
     gtttcaatcg gttttgctta catcatcatg gccgcttaca tgctgctatt caacaccatt       360
     ggattagtcg attttggcgg taagaacatt ggtggtctgc tgttgttgga cctggtattt       420
     gtcatctttg ctattacgtt tggtggtgcc ttttgtgtca ttatcagaaa cgaagatctt       480
     tcaaccaatc tattaaatct tttgatcaac gtgtttgcca tcgcttaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page