(data stored in SCRATCH zone)

EMBL: CP000423.PE142

CP000423.PE142       Location/Qualifiers
FT   CDS_pept        145156..145647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0144"
FT                   /product="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69008"
FT                   /db_xref="GOA:Q03CR4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CR4"
FT                   /protein_id="ABJ69008.1"
FT                   /translation="MQYTRLAMPNHAYFIVADQGKLAFVGSPDAPLSEAADYVSGSLEF
FT                   NQEEMLPFQNAIDDYLTGKAQTITVPVTYHGTPLQEAVWQYLQTIPYGETRTYAQVAAA
FT                   VGHSHAFQAVGSAVGKNPVMIAVPCHRVLRKDGGLGGFRGGLPMKRDLLALEQGQRPIF
FT                   "
     atgcaataca cacggttagc aatgcccaat cacgcctatt ttatcgtggc cgatcaaggg        60
     aaactggcct tcgtcgggtc accggatgcg ccgcttagcg aggcggctga ttatgtcagc       120
     ggttcacttg aatttaatca agaagagatg ttgccgtttc aaaacgccat tgatgattat       180
     cttactggca aggcgcaaac catcacagta ccggtgactt accatgggac accgctgcaa       240
     gaagccgttt ggcagtatct gcagacgatt ccttatggag agacccgaac gtacgcacag       300
     gtggcagccg cagtcggtca ttcgcacgcc ttccaagcag tcggctctgc ggtcggaaag       360
     aatcccgtta tgatcgctgt gccttgtcat cgcgtcctgc gcaaagatgg tggtttgggt       420
     ggctttcgtg gcggtttgcc aatgaagcgc gacttgttgg cacttgaaca agggcagcgg       480
     cccatttttt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page