(data stored in SCRATCH zone)

EMBL: CP000423.PE153

CP000423.PE153       Location/Qualifiers
FT   CDS_pept        complement(153621..154196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69019"
FT                   /db_xref="GOA:Q03CQ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CQ3"
FT                   /protein_id="ABJ69019.1"
FT                   /translation="MQSFEKYHPIMSVHYTMDWLTTFKIKDIFQLRADRQIAAESGREF
FT                   DQRITDTARYINRSMRLVMSNNALLYGIKDRANGDFLGSFCIWNFSEKKTVAQVRFETL
FT                   AERQGEGVMSEVLKRMLGFAFFELGLKRVYVILPATNERAAKLLAANVFTQVGDYHHDR
FT                   TLPDGTKVPLARFELSADAVADNDAFHF"
     atgcaaagtt ttgagaagta ccatccaatc atgtccgtgc attacaccat ggactggttg        60
     acgacattta aaatcaagga tattttccag ttgcgcgccg atcggcaaat tgccgcagaa       120
     tcaggccgtg aattcgatca aagaatcacc gacacggccc gctacatcaa tcgttccatg       180
     cgcctcgtca tgagtaacaa cgccttgtta tacgggatca aggatcgtgc taatggtgat       240
     tttcttggca gtttctgtat ttggaacttc agtgaaaaga aaaccgttgc ccaagtacgc       300
     ttcgaaacct tggccgagcg tcaaggtgaa ggcgttatga gtgaagtcct caaacggatg       360
     cttggctttg ccttctttga attaggtctc aaacgggttt atgtcatctt gccagccacc       420
     aacgaacgag cagcgaaatt gttagccgcc aacgtcttca cacaggtcgg tgattatcac       480
     cacgaccgca ctttaccgga tggcaccaaa gttccactgg cgcgctttga attgtcggct       540
     gatgctgttg ccgataatga cgcctttcat ttttaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page