(data stored in SCRATCH zone)

EMBL: CP000423.PE155

CP000423.PE155       Location/Qualifiers
FT   CDS_pept        156612..156971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69021"
FT                   /db_xref="GOA:Q03CQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CQ1"
FT                   /protein_id="ABJ69021.1"
FT                   /translation="MKKMILLTVLLLGFACNPFSQVDAAEAGDGYTSGAEVGFYESPSS
FT                   ASTDSQAKKAGTGQTDDAKDRPDAQTTNADQFGFMPRLGTTQAWLCSMAGLLTILIITL
FT                   LLILKRNGKDKEEEN"
     atgaaaaaaa tgattttact gactgtcctc ttattgggct tcgcctgcaa cccgttttca        60
     caggttgatg cagccgaagc aggggatggc tatacctcag gcgctgaagt tggcttttac       120
     gaatcaccgt catccgctag tactgacagt caggctaaaa aagcagggac agggcaaact       180
     gatgacgcga aagacagacc tgatgcgcaa acaacgaatg cagatcaatt tggcttcatg       240
     ccacggcttg gtacaacgca agcttggctt tgcagcatgg ccggcttgtt gacgatactc       300
     attatcacat tgcttttgat tctcaaacga aatggaaaag acaaggaaga ggaaaattaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page