(data stored in SCRATCH zone)

EMBL: CP000423.PE158

CP000423.PE158       Location/Qualifiers
FT   CDS_pept        158768..159847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0160"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69024"
FT                   /db_xref="GOA:Q03CP8"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP8"
FT                   /protein_id="ABJ69024.1"
FT                   /translation="MKKTIFCIAAFVAMLMTPAAHVFASELNFAAKAQMPDNQVNKGVS
FT                   YFDIKMDQGAKQALHVDLRNDTEKEVAVDVGIASATTNINGVVEYGQNAIKPAKSLAFN
FT                   MKDYVKTPAQVKIPAKGSTVLNLDVTMPSKPLHGVMAGGITLKEHQPGDQAAKDAGKGV
FT                   AINNRFSYVIGLLMQQSTDQVAAHVKLNDVKPSQINYRNVILASMENDAATFVNKVAVD
FT                   AKIMAKGSDKSVYQVAKEGLQMAPDTTFDFPIALEGKTLKPGTYVAHLEVYGNQQADGG
FT                   MTRKTADGKQHYHDHWTLTKQFTITDKVAKNLNQKDVSIKKDNSWQLYALIAVVAVLIM
FT                   IVALLLVIVFKRKKKEQAS"
     gtgaaaaaaa caattttctg tatagcagcg tttgttgcca tgttgatgac ccctgcagcc        60
     catgtttttg cctcagaatt gaactttgcg gccaaggccc agatgccgga caatcaggtc       120
     aataaaggtg ttagctattt tgacatcaaa atggatcagg gtgctaagca ggccctgcat       180
     gttgacttgc gaaacgatac agaaaaagag gtggctgtgg atgttggcat tgccagtgca       240
     acgacgaata ttaacggcgt ggttgaatac ggtcaaaatg ccatcaagcc agcgaaaagc       300
     cttgccttta acatgaagga ttatgtcaaa acgccagctc aggtcaagat ccctgctaaa       360
     ggcagcacgg ttttaaatct tgatgtgacc atgccaagca aaccactcca tggcgtgatg       420
     gcaggcggca ttaccttgaa ggaacatcag ccaggcgatc aagctgcaaa agatgcaggt       480
     aaaggggttg ccatcaacaa tcgcttctcg tacgtgattg gcttattgat gcaacaaagt       540
     actgatcagg tagcggctca tgtgaaattg aatgatgtta agccgagtca gatcaattac       600
     cgcaatgtga tcttggcatc catggaaaac gatgccgcga cgttcgtcaa caaagtggcg       660
     gttgatgcca aaattatggc taaaggttcg gataaatctg tctatcaagt ggctaaagaa       720
     ggcttgcaaa tggcgccgga cacgaccttc gattttccaa ttgcgttaga aggcaagacg       780
     cttaagccgg gtacgtatgt tgctcatctt gaggtgtatg gcaatcagca ggcagatggc       840
     gggatgactc gtaaaacagc tgatggcaaa cagcattacc atgatcactg gacgctgaca       900
     aagcaattca cgattaccga taaagtggcc aaaaatctga atcaaaaaga tgtctcgatt       960
     aaaaaagata atagctggca attgtatgca ctcattgctg ttgtcgctgt actgatcatg      1020
     attgtggcgc ttctactcgt cattgttttc aaacgaaaga agaaggagca agcgtcctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page