(data stored in SCRATCH zone)

EMBL: CP000423.PE159

CP000423.PE159       Location/Qualifiers
FT   CDS_pept        160072..160305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69025"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP7"
FT                   /protein_id="ABJ69025.1"
FT                   /translation="MKDTEAEEKAAQQNLHIWLSDMFTADDQSVRIFDVDRYKQSGKTT
FT                   QQQAYLANIAYRFAGKTLLARTGTISKTRWIL"
     gtgaaggaca ctgaagcgga agaaaaagca gcccaacaaa atttgcacat ttggttatcg        60
     gacatgttta ctgccgatga ccaaagtgtg cgaatttttg atgtggacag gtacaaacaa       120
     agtgggaaaa caacgcaaca acaagcatat ttggccaata ttgcttaccg ttttgctggg       180
     aaaacattgc tggcacgtac aggtacgatc tcaaaaacaa ggtggatttt gtga             234
//

If you have problems or comments...

PBIL Back to PBIL home page