(data stored in SCRATCH zone)

EMBL: CP000423.PE162

CP000423.PE162       Location/Qualifiers
FT   CDS_pept        complement(162962..163291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69028"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP4"
FT                   /protein_id="ABJ69028.1"
FT                   /translation="MTQMPSSLQGFPKGEFAAFSTAKMTHFLPYSQETSTDDLKGFFGA
FT                   NYQYLTKTPIGRLKIDIPNTEQLIVQYGEIIARFTNGKFKIIDSTYFHKNFNDPLVDED
FT                   EKGIY"
     atgacacaaa tgccttcatc actacaagga tttccaaaag gtgaattcgc agctttttca        60
     actgcaaaaa tgacccactt cttaccttac tcacaagaaa ccagcactga cgacttgaaa       120
     ggcttctttg gcgcaaatta ccaatacctc accaaaaccc cgattggccg tctcaaaatt       180
     gacatcccca acacggagca attgattgta caatacggtg agatcatcgc tcgcttcacc       240
     aatggcaaat tcaagatcat tgacagcacc tacttccaca aaaacttcaa tgatccgcta       300
     gtagatgagg atgaaaaggg tatctattag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page