(data stored in SCRATCH zone)

EMBL: CP000423.PE163

CP000423.PE163       Location/Qualifiers
FT   CDS_pept        163472..164818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0165"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69029"
FT                   /db_xref="GOA:Q03CP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CP3"
FT                   /protein_id="ABJ69029.1"
FT                   /translation="MDQSLFQNGNFQPLASRMRPQTLDEFVGQTHLLGKDKVLSNLIEH
FT                   DEISSMIFWGPPGVGKTTLARIIARRTKAQFVTFSAVTSGIKEIKQVMKEAEQNRELGQ
FT                   KTIVFVDEIHRFNKAQQDAFLPYVERGSIILIGATTENPSFEVNAALLSRTRVFVLHGL
FT                   TSAELVDLLQRALKDPRGYGLQKVKIGKKLLAQIADFANGDARIALNTLEMAVTNAETK
FT                   GGVITVTQADVAQLLTKKALLYDKNGEEHYNLISALHKSMRNSDVDAAIYWLARMLEAG
FT                   EDPLYVARRLVRFASEDIGMADSRALEITIAVYQACQFIGMPECTVHLTHAVTYLALAP
FT                   KSNALYTAYEGAKKDATETLAEPVPLQIRNGVTDLMQDLGYGKDYQYAHNTKDKLTTMQ
FT                   TMPDNLIGKTYYHPTTQGSEAKVKERLEQIKAWHAQHPDPDSPKTKKKS"
     atggatcaaa gtctatttca aaatggtaac ttccaacctt tggcgagtcg tatgcggcca        60
     cagacgcttg atgagtttgt cggccaaacg catttgctag ggaaggataa ggtgctcagc       120
     aatcttatcg aacatgacga gattagttcc atgattttct ggggtccgcc tggtgtcggt       180
     aaaacaacat tggcgcggat cattgctcgg cgaacgaagg cacagtttgt gacattttca       240
     gcagtcacca gcgggattaa agaaatcaag caggtgatga aagaggctga acagaatcgc       300
     gagctgggtc agaaaaccat tgtgtttgtt gatgaaattc atcgtttcaa caaggcgcag       360
     caggatgcct ttctgccata tgtcgaacgc ggcagcatta tcctgattgg tgcgacaacc       420
     gagaatcctt cgtttgaagt caatgcggca ctcttgtcac ggacgcgggt tttcgtgttg       480
     cacggcttga ccagtgctga attggttgac ctgttacagc gagcgttaaa agatccgcgc       540
     ggttatggtc tgcagaaggt taagatcggc aaaaagctct tagctcagat tgctgatttt       600
     gctaacgggg atgctcgaat cgctttgaac accttggaga tggcggtgac aaacgccgaa       660
     accaaaggcg gcgtgataac ggtcacccaa gcagatgtgg cccagttgtt gacgaagaaa       720
     gccttattgt atgacaagaa tggtgaggag cactataatc taatatcagc attacacaaa       780
     tcaatgcgca attccgatgt tgatgcggcc atttattggc tggctcgaat gctggaagca       840
     ggggaagacc ccttgtatgt cgctcggcgg ctagttcgat ttgcgagcga agatatcgga       900
     atggccgact cacgcgcatt ggagattaca attgctgttt atcaggcgtg tcaatttatt       960
     gggatgcctg agtgcacggt tcatctcaca catgcagtca cctatttggc acttgcaccg      1020
     aaatcgaatg cactctacac agcgtatgaa ggcgcaaaga aagatgcgac cgaaacgctg      1080
     gccgaaccag ttccacttca gattcgaaat ggggtaacgg atttgatgca ggatctgggt      1140
     tatggtaagg actatcaata tgctcacaac acaaaagata aactaacgac catgcaaacc      1200
     atgccggata atcttatcgg caaaacgtac tatcatccca cgactcaagg cagcgaagcc      1260
     aaggtcaagg aacggctaga gcagatcaag gcctggcatg cgcaacaccc tgaccccgat      1320
     tcgccgaaaa ccaagaaaaa gtcatga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page