(data stored in SCRATCH zone)

EMBL: CP000423.PE192

CP000423.PE192       Location/Qualifiers
FT   CDS_pept        196192..196434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69058"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CL4"
FT                   /protein_id="ABJ69058.1"
FT                   /translation="MSEEIVFFNPGDAVANDFDFAAARRSAQIYKAEHVVDEGLVVAKD
FT                   KDGKYSVFYEAAGTPDSKAKGDYKAVGKYTILAHL"
     atgagcgaag aaattgtttt cttcaacccc ggcgatgcag tcgccaatga ttttgatttc        60
     gccgcggctc gacgcagtgc ccaaatttac aaagccgaac atgttgtcga tgaaggcttg       120
     gttgtcgcta aagataaaga cggcaagtat tccgtttttt acgaagctgc cggaacgcct       180
     gattcaaagg ctaaaggtga ctataaagca gttggcaagt atacgattct ggctcatcta       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page