(data stored in SCRATCH zone)

EMBL: CP000423.PE2

CP000423.PE2         Location/Qualifiers
FT   CDS_pept        1603..2742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68868"
FT                   /db_xref="GOA:Q03D54"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D54"
FT                   /protein_id="ABJ68868.1"
FT                   /translation="MKFTITRSTFLKTLNDVSRAISTKTTIPILTGLKIVLNDSGLILT
FT                   GSDADISIESRINATDENNDLQIGSTGEIVLPARFFSEIVKRLPESTMTLEVKDNFQTV
FT                   ITSGASEFTINGLDANNYPRLPEITADAALSVSADVLRQLINQTVIAVSNQESRPILTG
FT                   VHLTITGDQLVAVATDSHRLAQRSLTLPTASASDYDIIIPGKSLTELSRMLSDDVEKIE
FT                   IRIAENQVLFVFGQTAFYSRLLEGNYPDTSRLIPTSSNTQAEFDAPALLASIQRASLLS
FT                   HESSNNVVRLVLNIADQKATIYGNSPDVGNVEEVLSFNKLSGEDLEISFNPDYMKDALQ
FT                   GFGQTAIEVDFTAPLRPFTLVPTEDKERFIQLITPVRTF"
     atgaaattta cgatcacccg atccacattc ttaaaaacct tgaatgatgt ttctcgggcc        60
     atttcaacca aaacaaccat tccgattctg actggattga aaattgtgct caacgatagc       120
     ggcttaatcc tcactggtag tgatgccgat atttcaatcg aatcacggat caacgcaacg       180
     gatgaaaata atgatctcca aatcggaagc actggtgaaa tcgtcttgcc agcccgtttc       240
     tttagcgaaa tcgttaaacg tttgccagaa agcacaatga cgcttgaagt taaagacaat       300
     ttccaaaccg tcatcacgtc tggggcatct gaatttacca ttaatggttt ggatgccaat       360
     aactatccgc ggttgccaga aattacagcc gatgcagcgt tgagtgtttc agctgatgtg       420
     ttacgtcagt tgattaacca aacagttatt gccgtttcta atcaggaaag tcgaccaatc       480
     ttgacagggg ttcatctgac aattaccggc gatcagttgg tagctgttgc gactgattcc       540
     caccgccttg cgcaacgtag cctgacctta ccaacagcaa gtgcctcgga ttatgacatc       600
     attattccag ggaaaagtct gacagaactt agccgcatgt taagcgatga cgttgaaaaa       660
     atcgaaattc gcattgcgga aaatcaagtg ctgttcgtgt ttgggcaaac ggccttttat       720
     tcacgcttac ttgaaggcaa ctaccctgac acaagccgac ttattccaac atccagcaat       780
     acgcaagcgg aatttgacgc accagcattg ctggcctcca ttcaacgtgc cagcttgctg       840
     agtcacgaaa gtagcaacaa tgtagttcgg cttgtcctta atatcgctga tcaaaaagcg       900
     actatctacg gtaattcgcc agatgtcggg aatgttgaag aagtacttag tttcaacaaa       960
     cttagcggcg aggatctaga aatctcgttc aaccctgatt atatgaagga tgccttgcaa      1020
     ggatttggcc aaacggcaat tgaagttgac ttcaccgcac cattgcgacc attcactttg      1080
     gttccaacag aagacaagga acggtttatc caactcatca cgccagttcg aacgttctaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page