(data stored in SCRATCH zone)

EMBL: CP000423.PE20

CP000423.PE20        Location/Qualifiers
FT   CDS_pept        complement(20173..21363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0020"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ68886"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q03D36"
FT                   /protein_id="ABJ68886.1"
FT                   /translation="MKFNKVMITLVAAVTLAGSASAVTPVFADTSDSIASNKSETNALL
FT                   KQIEDANTEVINLNKQIDTKNGQISDATAKISATDAKISSLSGEIVAAQKNVTARKNNL
FT                   KDQLISLQKKAGNSVSGNVYIDFVLNSQNLSDLIARTMTVGKLSQASKDALDAVTVAKD
FT                   KLAGLKTEQENARQTLVSTKASLETQKSQLVSLQKDANDKQDALNKQIADHKDELVALQ
FT                   SQFAQEQSEAAAATQAALKTVAASTASSSTTSSSSSATSTSTIANNTASGSGSHADFSG
FT                   SGNTYPWGQCTWYVKSVAPWAGNGWGNGAQWGGSAAAAGFTVNHTPAAGSIIVFAAGQS
FT                   VGGQWTADGSYGHVAYVQSVSGDSVTISQGGMGFSSPTGPNTQTISGASSYVYIHR"
     atgaaattca ataaagtcat gatcacgttg gttgctgcag ttaccttagc aggttctgct        60
     agcgccgtaa caccagtttt cgctgataca agcgacagta tcgcttccaa caaaagcgaa       120
     accaatgcac tgttgaagca aattgaagat gcgaacacag aagttatcaa tttgaacaag       180
     cagatcgata ccaagaatgg tcaaatcagc gatgcaacgg ctaagatcag cgcaactgat       240
     gccaagattt catcactcag cggtgaaatt gttgccgctc aaaagaatgt cacagcacgc       300
     aagaacaact tgaaagatca gttgatctcc ttgcagaaaa aggctggcaa ctctgtcagc       360
     ggcaatgtct atatcgactt tgttctgaat tcccagaact tgtctgactt aattgcccgc       420
     accatgacgg ttggcaaact tagccaagcc agcaaagatg cgcttgatgc cgtgacagtt       480
     gccaaggata aattagctgg cttgaagacg gaacaggaaa atgcccgtca gacgctggtt       540
     tcaactaagg cttcattgga aacccagaaa tcacagttgg tttccctaca aaaagatgct       600
     aacgataaac aagatgcttt gaataaacaa attgctgatc ataaagatga gttggttgct       660
     ttgcaaagcc aatttgccca agaacagtct gaagcagctg ctgcaaccca agccgctttg       720
     aagaccgttg ccgcttcaac cgcaagttct tctactacca gcagttcaag cagcgcaact       780
     tcaaccagca ccatcgccaa caacacagct tcaggcagtg gcagccacgc tgacttcagt       840
     ggttcaggta acacctatcc ttggggtcag tgcacctggt acgtcaaatc agttgcacca       900
     tgggctggta atggctgggg caacggcgca caatggggcg gttcagccgc agcagctggc       960
     ttcactgtta accacacgcc agcagccggc tcaatcatcg tcttcgccgc tggtcaatcc      1020
     gttggcggtc aatggacagc cgatggttca tatggtcacg ttgcttatgt ccaatctgtc      1080
     tccggtgaca gtgtcacgat cagccaaggc ggcatgggct tcagctcacc aaccggcccg      1140
     aacacccaaa ccatctctgg tgcaagcagc tacgtttata tccaccggta a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page