(data stored in SCRATCH zone)

EMBL: CP000423.PE210

CP000423.PE210       Location/Qualifiers
FT   CDS_pept        207954..208826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0213"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69076"
FT                   /db_xref="GOA:Q03CJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CJ6"
FT                   /protein_id="ABJ69076.1"
FT                   /translation="MANKNNKGLGRGIDAIFKDFESPDLSANNTVEELPLIDIRPNPYQ
FT                   PRKTFDEEGLKELAGSIKQTGVFQPIIVRKSVSGYEIITGERRFRASKLAGKETIPSIV
FT                   RDFNDPEMMEIAVLENLQREDLTPLDEAQAYDTLIKRLNLTQAEVSARLGKSRPYIANY
FT                   LRLLTLPQQVKQMLSANQLSMGQARTLLSLKDKSKMVSVAKKTINENLTVRQLERLINQ
FT                   MNAGNTRPATKEKPKSPYVRATENQLGERFGTKVNINEGNKGKGKIEIDFTSEKDLNRI
FT                   LAMLDVNID"
     atggcgaata agaataacaa aggcttaggc cgtggtattg atgcgatttt caaagatttc        60
     gaaagtccag atctgagtgc caataataca gttgaagaat taccgctgat tgacatccga       120
     ccaaatccct accaaccgcg taaaacgttt gatgaggaag gcttgaagga actggctggt       180
     tcgatcaaac aaaccggcgt gttccaaccg atcattgtcc gcaagagtgt ttcaggctat       240
     gagattatta ccggtgaacg tcgcttccgt gcgtctaaat tggctggcaa ggagactatt       300
     ccatccattg ttcgggactt caatgatccc gaaatgatgg aaatcgctgt gctggaaaac       360
     ttgcagcggg aagatctgac gccgctagac gaagcccagg cttatgacac cttgatcaag       420
     cgtctgaatc tgacgcaagc agaagtatcg gcacgacttg gcaaaagccg accttatatt       480
     gcgaactact tacgcctttt gacactgccg cagcaagtca aacaaatgtt aagtgccaat       540
     cagctgtcaa tgggacaagc acggacgctg ttaagtctca aagataagtc caaaatggtg       600
     agtgtggcca agaagacaat caatgaaaac ctgactgtgc gccagctaga acggctcatt       660
     aatcagatga atgctggcaa cacgcgcccg gcaaccaaag aaaagccaaa gtcgccatac       720
     gtgcgggcaa ctgagaacca acttggcgaa cgctttggca ccaaggtgaa tattaatgaa       780
     ggcaacaaag gcaaaggcaa gatcgagatt gacttcactt ccgaaaaaga tttgaatcgg       840
     atcttggcca tgctcgacgt caatattgac taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page