(data stored in SCRATCH zone)

EMBL: CP000423.PE241

CP000423.PE241       Location/Qualifiers
FT   CDS_pept        complement(243464..244312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0244"
FT                   /product="Diadenosine tetraphosphatase related
FT                   serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69107"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CG5"
FT                   /protein_id="ABJ69107.1"
FT                   /translation="MTTIAILSDIHGNMTAFSAVIQDAKAHQADEYWFLGDLFLPGPGS
FT                   DKLWATLHGLKPTHIVKGNWDDDLFWVLDGPVDLSQPTDVYFSRLVAYLWPHLTAENLA
FT                   TIRNWPLHEVFEQDGLIVSLAHNLPDKNHGHALYPDQPQLNFDQIAPDSQIDLAVYGHT
FT                   HQQLLRYTSNGQVILNPGSIGQAYSPRPHLQTTTYADYALLQLNDGAITDLDLRQVPYD
FT                   VSAELSLAKQQQLPYPEVYTKLRHTGATSTHNAAYLKQFEQRHDYQQEVAEFLHKYRHQ
FT                   H"
     atgacgacaa tcgccatttt atcggatatt cacggcaata tgacggcctt ttcagcggtc        60
     attcaggatg cgaaggcgca tcaggcggat gaatactggt ttctaggcga tctgttttta       120
     cccggtccag gttctgataa gttatgggcg acgctgcacg gactcaaacc cacacatatc       180
     gttaaaggca actgggatga cgatttattc tgggtactgg atggaccagt tgatctgtca       240
     cagccaacag atgtttactt tagtcgactg gttgcctatc tgtggccgca cctcacggct       300
     gaaaatctgg caacaattcg aaattggccg ctgcatgaag ttttcgagca agatggtttg       360
     atcgtcagtc tagcacataa ccttcctgac aaaaatcatg gacatgcctt atatcctgat       420
     caaccacaac tcaactttga ccaaattgcc cccgattcgc aaattgatct agctgtttat       480
     gggcataccc accaacagct actgcgctac accagtaacg gtcaagtcat cctcaatcca       540
     ggttctattg gccaagccta ttcaccccgg ccacacctgc aaacaaccac ttacgccgac       600
     tatgcattgc tgcaactcaa tgatggtgcc atcaccgatc ttgatctgcg gcaggtgcct       660
     tacgacgtgt ccgcagagtt atcactagcc aagcaacagc agttacctta tcctgaggtt       720
     tacacgaagt tacgccacac tggcgccacc agcactcaca atgctgctta cctcaaacaa       780
     ttcgaacagc gccacgatta ccaacaggaa gttgctgaat ttctgcacaa atatcgccat       840
     caacactaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page