(data stored in SCRATCH zone)

EMBL: CP000423.PE277

CP000423.PE277       Location/Qualifiers
FT   CDS_pept        complement(283774..283962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69143"
FT                   /db_xref="GOA:Q03CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q03CC9"
FT                   /protein_id="ABJ69143.1"
FT                   /translation="MLENNLVLKNFSCIDDSELAESQGGIGVVATGVIIGSLTVFLSGV
FT                   FSGFTDGMTQEKKPATV"
     atgttggaaa ataacttagt gcttaaaaac ttttcgtgca tcgatgattc agaattagca        60
     gaaagtcaag gcggcatcgg tgttgtcgct accggcgtca tcattgggag cctcactgta       120
     tttctgtccg gtgtcttctc tggctttacg gatggcatga cgcaagaaaa gaaacctgca       180
     actgtataa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page