(data stored in SCRATCH zone)

EMBL: CP000423.PE346

CP000423.PE346       Location/Qualifiers
FT   CDS_pept        353626..354336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LSEI_0353"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /db_xref="EnsemblGenomes-Gn:LSEI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ69212"
FT                   /db_xref="GOA:Q03C60"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q03C60"
FT                   /protein_id="ABJ69212.1"
FT                   /translation="MKTISIRLTSPLQSYGNEAQFARRTTGDYPSKSAIIGMLAAALGY
FT                   QRDDPAINALNDLLFAVRVDQPGQVMTEFQTAEWKPGTRKLTYRDLLQDAVFVVAIGSE
FT                   DEAWLDRLAEALRHPRFQLYLGRRANVPAGVLKIQTFAGQDPVGVLAQLPWQASRWYQR
FT                   RSRRQASMSVQLIADAVLLPERRADLVRDAVHSFDQKHRQYSFRPIAVTKVQLANPEYK
FT                   PAPTATAQDAFGQV"
     atgaaaacga tctcgatcag gctaactagc ccgctgcagt cgtacgggaa tgaggcccag        60
     tttgcgcggc ggacgaccgg ggattacccc tcaaaaagtg cgattatcgg gatgcttgcg       120
     gcggcgctgg gctatcaacg cgacgatccg gcgatcaatg cgctcaacga cctgctcttt       180
     gcggtgcgcg ttgatcagcc cggccaggtg atgacggagt tccagactgc ggagtggaaa       240
     cccggtacgc ggaagctgac gtatcgtgac ctgcttcagg atgccgtgtt tgtcgtggcc       300
     atcgggagcg aggacgaggc gtggctcgac cggctggccg aggcgctgcg ccatccgcgg       360
     tttcagctgt acctggggcg gcgggccaac gtgccggccg gcgtgttgaa aattcagacc       420
     ttcgccgggc aggatccggt cggggtgctg gcccagctgc cttggcaggc ctcgcgctgg       480
     taccagcggc gttcgcggcg tcaggcaagc atgagcgttc agttgatcgc ggatgctgtc       540
     ctgttaccag agcgccgggc cgatttggtc agggatgctg tgcactcttt tgaccaaaag       600
     caccggcaat acagttttcg ccccatcgcc gtgaccaagg tgcagctggc caatccggaa       660
     tacaagccag cgcccacggc cactgcgcag gatgccttcg gtcaagtata g                711
//

If you have problems or comments...

PBIL Back to PBIL home page